DR403520
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DR403520 vs. ExPASy Swiss-Prot
Match: MT3_CARPA (Metallothionein-like protein type 3 OS=Carica papaya PE=3 SV=1) HSP 1 Score: 88.1965 bits (217), Expect = 3.419e-17 Identity = 39/56 (69.64%), Postives = 46/56 (82.14%), Query Frame = 3 Query: 93 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVRAAETEGNCKCGP 260 MSDTCGNCDCAD++QCVKKGSSY AD +ET+ S ++ VVMD AAE +G CKCGP Sbjct: 1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEKSIMT--VVMDAPAAENDGKCKCGP 54
BLAST of DR403520 vs. ExPASy Swiss-Prot
Match: MT3_MUSAC (Metallothionein-like protein type 3 OS=Musa acuminata PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 2.995e-13 Identity = 33/52 (63.46%), Postives = 39/52 (75.00%), Query Frame = 3 Query: 102 TCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVRAAETEGNCKCG 257 TCGNCDC D+SQCVKKG+SY D VET+ S+V V+V AAE +G CKCG Sbjct: 3 TCGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIVA-AEAAEHDGKCKCG 53
BLAST of DR403520 vs. ExPASy Swiss-Prot
Match: MT3_ACTDE (Metallothionein-like protein type 3 OS=Actinidia deliciosa GN=pKIWI503 PE=2 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 8.715e-13 Identity = 37/55 (67.27%), Postives = 41/55 (74.55%), Query Frame = 3 Query: 93 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVRAAETEGNCKCG 257 MSD CGNCDCAD SQCVKKG+S D VETD S++ VVM V AAE+ G CKCG Sbjct: 1 MSDKCGNCDCADSSQCVKKGNS--IDIVETDKSYIED-VVMGVPAAESGGKCKCG 52
BLAST of DR403520 vs. ExPASy Swiss-Prot
Match: MT3_PRUAV (Metallothionein-like protein 1 OS=Prunus avium GN=MT1 PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.662e-11 Identity = 32/56 (57.14%), Postives = 37/56 (66.07%), Query Frame = 3 Query: 93 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVRAAETEGNCKCGP 260 MS C NCDC+D SQC KKG S+ VET+ + T V+MD AAE GNCKCGP Sbjct: 1 MSSKCSNCDCSDSSQCTKKGYSFDLVIVETENRSMDT-VIMDAPAAENGGNCKCGP 55 The following BLAST results are available for this feature:
BLAST of DR403520 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DR403520 ID=DR403520; Name=DR403520; organism=Citrus sinensis; type=EST; length=600bpback to top |