FC868498

Overview
NameFC868498
Unique NameFC868498
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length728
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9339 contig Ccv1_Contig9339:1..729. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_PORYE (Elongation factor 1-alpha OS=Porphyra yezoensis PE=2 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.269e-81
Identity = 154/218 (70.64%), Postives = 172/218 (78.90%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPIS---GSRVTHD*EVYHL--DWYRGP 722
            MGKEK H++IVVIGHVDSGKSTTTGHLIYK GGI+KR IE+FEKEAAEM K SFKYAWVLDKLKAERERGITIDIALWKFET KY  T+IDAPGHRDFIKNMITGTSQAD A+L+I S  G FEAGIS++GQTREHALLA+TLGVKQMI  CNKMD     +S+ RY+E+ KE+  YLKKVGY P K    P S   G  +    +  H    WY+GP
Sbjct:    1 MGKEKQHVSIVVIGHVDSGKSTTTGHLIYKCGGIEKRAIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETEKYSFTIIDAPGHRDFIKNMITGTSQADLAILVIASPPGEFEAGISQNGQTREHALLAYTLGVKQMIVACNKMDDKNVNWSQDRYEEVSKEMDLYLKKVGYNPAKVPKVPTSGWTGENLFERTDKTHALGKWYKGP 218          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_PLAFK (Elongation factor 1-alpha OS=Plasmodium falciparum (isolate K1 / Thailand) GN=MEF-1 PE=3 SV=1)

HSP 1 Score: 296.975 bits (759), Expect = 6.962e-80
Identity = 151/215 (70.23%), Postives = 172/215 (80.00%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISGSRVTHD*EVY-HLDWYRGPT 725
            MGKEKTHIN+VVIGHVDSGKSTTTGH+IYKLGGID+R IE+FEKE+AEM K SFKYAWVLDKLKAERERGITIDIALWKFET +Y+ TVIDAPGH+DFIKNMITGTSQAD A+L++ +  GGF+   SK+GQT+EH LLAFTLGVKQ++   NKMD  T KYS+ RY+EI KEV  YLKKVGY   K    PISG    +  E      WY+G T
Sbjct:    1 MGKEKTHINLVVIGHVDSGKSTTTGHIIYKLGGIDRRTIEKFEKESAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETPRYFFTVIDAPGHKDFIKNMITGTSQADVALLVVPADVGGFDGAFSKEGQTKEHVLLAFTLGVKQIVVGVNKMD--TVKYSEDRYEEIKKEVKDYLKKVGYQADKVDFIPISGFEGDNLIEKSDKTPWYKGRT 213          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_SPOFR (Elongation factor 1-alpha (Fragment) OS=Spodoptera frugiperda PE=1 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.646e-79
Identity = 145/181 (80.11%), Postives = 158/181 (87.29%), Query Frame = 3
Query:  126 HVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISG 668
            HVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GY P      PISG
Sbjct:    1 HVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISG 181          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_HELZE (Elongation factor 1-alpha (Fragment) OS=Heliothis zea PE=3 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.646e-79
Identity = 145/181 (80.11%), Postives = 158/181 (87.29%), Query Frame = 3
Query:  126 HVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISG 668
            HVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GY P      PISG
Sbjct:    1 HVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISG 181          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_HELVI (Elongation factor 1-alpha (Fragment) OS=Heliothis virescens PE=3 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.646e-79
Identity = 145/181 (80.11%), Postives = 158/181 (87.29%), Query Frame = 3
Query:  126 HVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISG 668
            HVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GY P      PISG
Sbjct:    1 HVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISG 181          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_HELGL (Elongation factor 1-alpha (Fragment) OS=Helicoverpa gelotopoeon PE=3 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.646e-79
Identity = 145/181 (80.11%), Postives = 158/181 (87.29%), Query Frame = 3
Query:  126 HVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISG 668
            HVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GY P      PISG
Sbjct:    1 HVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISG 181          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_HELDI (Elongation factor 1-alpha (Fragment) OS=Heliocheilus discalis PE=3 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.646e-79
Identity = 145/181 (80.11%), Postives = 158/181 (87.29%), Query Frame = 3
Query:  126 HVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISG 668
            HVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GY P      PISG
Sbjct:    1 HVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISG 181          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_HELAM (Elongation factor 1-alpha (Fragment) OS=Helicoverpa armigera PE=3 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.646e-79
Identity = 145/181 (80.11%), Postives = 158/181 (87.29%), Query Frame = 3
Query:  126 HVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISG 668
            HVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GY P      PISG
Sbjct:    1 HVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISG 181          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_HELAL (Elongation factor 1-alpha (Fragment) OS=Heliocheilus albipunctella PE=3 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.646e-79
Identity = 145/181 (80.11%), Postives = 158/181 (87.29%), Query Frame = 3
Query:  126 HVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISG 668
            HVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GY P      PISG
Sbjct:    1 HVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISG 181          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_ANIIF (Elongation factor 1-alpha (Fragment) OS=Anicla infecta PE=3 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.646e-79
Identity = 145/181 (80.11%), Postives = 158/181 (87.29%), Query Frame = 3
Query:  126 HVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISG 668
            HVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GY P      PISG
Sbjct:    1 HVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISG 181          
The following BLAST results are available for this feature:
BLAST of FC868498 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_PORYE1.269e-8170.64Elongation factor 1-alpha OS=Porphyra yezoensis PE... [more]
EF1A_PLAFK6.962e-8070.23Elongation factor 1-alpha OS=Plasmodium falciparum... [more]
EF1A_SPOFR2.646e-7980.11Elongation factor 1-alpha (Fragment) OS=Spodoptera... [more]
EF1A_HELZE2.646e-7980.11Elongation factor 1-alpha (Fragment) OS=Heliothis ... [more]
EF1A_HELVI2.646e-7980.11Elongation factor 1-alpha (Fragment) OS=Heliothis ... [more]
EF1A_HELGL2.646e-7980.11Elongation factor 1-alpha (Fragment) OS=Helicoverp... [more]
EF1A_HELDI2.646e-7980.11Elongation factor 1-alpha (Fragment) OS=Heliocheil... [more]
EF1A_HELAM2.646e-7980.11Elongation factor 1-alpha (Fragment) OS=Helicoverp... [more]
EF1A_HELAL2.646e-7980.11Elongation factor 1-alpha (Fragment) OS=Heliocheil... [more]
EF1A_ANIIF2.646e-7980.11Elongation factor 1-alpha (Fragment) OS=Anicla inf... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31001B02EF AbioticL1 Citrus clementina cDNA clone C31001B02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868498 ID=FC868498|Name=FC868498|organism=Citrus clementina|type=EST|length=728bp
GACTCTTTGCCCTCCCTCTTTTCTTGCTTGCTCTGCGGCTAGGTTTCAAT
TGTCTCTTCGAAGTTTCAGTTAATTTAACAGCCATGGGTAAGGAGAAGAC
TCACATCAACATTGTGGTGATTGGCCATGTCGACTCTGGAAAGTCGACCA
CCACCGGACACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTGATC
GAGAGGTTCGAGAAGGAAGCTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACACCCCGAGAAAGTCCCAT
TCGTGCCCNATCTCTGGTTCGAGGGTGACACATGATTGAGAGGTCTACCA
CCTTGACTGGTACAGGGGTCCAACCTGC
back to top