FC868498

Overview
NameFC868498
Unique NameFC868498
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length728
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9339 contig Ccv1_Contig9339:1..729. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_ADIBE (Elongation factor 1-alpha (Fragment) OS=Adisura bella PE=3 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.646e-79
Identity = 145/181 (80.11%), Postives = 158/181 (87.29%), Query Frame = 3
Query:  126 HVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISG 668
            HVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GY P      PISG
Sbjct:    1 HVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISG 181          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_STYLE (Elongation factor 1-alpha OS=Stylonychia lemnae GN=EFAA PE=3 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 1.896e-77
Identity = 149/215 (69.30%), Postives = 168/215 (78.14%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISGSRVTHD*EVY-HLDWYRGPT 725
            M KEK H+N+VVIGHVDSGKST+TGHLIYK GGIDKR IE+FEKEAAEM K SFKYAWVLDKLKAERERGITIDIALW FET K   T+IDAPGHRDFIKNMITGTSQAD A+LII S  G FEAGISK+GQTREHALLAFT+GVKQMI   NKMD  +  + + R+ EI KE+S YLKK+   PR+    PISG    +  E   ++ W+ G T
Sbjct:    1 MPKEKNHLNLVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWNFETAKSVFTIIDAPGHRDFIKNMITGTSQADAAILIIASGQGEFEAGISKEGQTREHALLAFTMGVKQMIVAVNKMDDKSVNWDQGRFIEIKKELSDYLKKIWLQPRQDPFIPISGWHGDNMLEKSPNMPWFTGST 215          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_CRYPV (Elongation factor 1-alpha OS=Cryptosporidium parvum PE=2 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 3.234e-77
Identity = 153/217 (70.51%), Postives = 170/217 (78.34%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISGSRVTHD*EVYHLD---WYRGPT 725
            MGKEKTHIN+VVIGHVDSGKSTTTGHLIYKLGGIDKR IE+FEKE++EM K SFKYAWVLDKLKAERERGITIDIALW+FET KY+ TVIDAPGHRDFIKNMITGTSQAD A+L++ +    FE   SK+GQTREHALLAFTLGV+QMI   NKMD  T +Y ++R+DEI  EV  YLKKVGY   K     ISG     D  V   D   WY+G T
Sbjct:    1 MGKEKTHINLVVIGHVDSGKSTTTGHLIYKLGGIDKRTIEKFEKESSEMGKGSFKYAWVLDKLKAERERGITIDIALWQFETPKYHYTVIDAPGHRDFIKNMITGTSQADVALLVVPADR--FEGAFSKEGQTREHALLAFTLGVRQMIVGINKMD--TCEYKQSRFDEIFNEVDGYLKKVGYNTEKIPFVAISG--FVGDNMVERSDKMPWYKGKT 211          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A1_XENLA (Elongation factor 1-alpha OS=Xenopus laevis PE=1 SV=2)

HSP 1 Score: 284.263 bits (726), Expect = 4.670e-76
Identity = 131/198 (66.16%), Postives = 161/198 (81.31%), Query Frame = 3
Query:   75 LTAMGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISG 668
            +T    +KTH+NIV+IGHVDSGKSTTTGHLIYK GG D R +E+ E  AA++ K SFK+AW+LDKLKAERERGITIDI+LWKF+T ++  T+IDAPGHRDFIKNMITGTSQAD A+L++ + TG FEAG+S++GQTREHALLA+T+GVKQ+I C NKMD T P YS  R+DE+V+ V  YLKK+GY P      P+SG
Sbjct:    1 MTDKAPQKTHLNIVIIGHVDSGKSTTTGHLIYKCGGFDPRALEKVEAAAAQLGKSSFKFAWILDKLKAERERGITIDISLWKFQTNRFTITIIDAPGHRDFIKNMITGTSQADVALLVVSAATGEFEAGVSRNGQTREHALLAYTMGVKQLIVCVNKMDLTDPPYSHKRFDEVVRNVMVYLKKIGYNPATIPFVPVSG 198          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_BLAHO (Elongation factor 1-alpha OS=Blastocystis hominis PE=2 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 2.318e-75
Identity = 146/220 (66.36%), Postives = 168/220 (76.36%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGY--TPRKSHSCPISG----SRVTHD*EVYHLDWYRGPT 725
            MGKEK HIN+VVIGHV +GKSTTTGHLIY  GGIDKR IERFE+    + K SFKYAWVL K+KAERERGITIDI+LWKFET K + T+IDAPGHRDFIKNMITGTSQAD A+L+I S  G FEAG SK+GQTREHALLA TLGVKQMI CCNKMD  +  YS+ARY EI  E++S+L KVGY     +    PISG    + + H     ++ WY+GPT
Sbjct:    1 MGKEKPHINLVVIGHVVAGKSTTTGHLIYACGGIDKRTIERFEEGGQRIGKGSFKYAWVLAKMKAERERGITIDISLWKFETRKDFFTIIDAPGHRDFIKNMITGTSQADVAILVIASGAGEFEAGYSKNGQTREHALLANTLGVKQMIVCCNKMDDKSVNYSEARYKEIKNEMTSFLTKVGYAKVEERIPFIPISGFNGDNMIEHS---ANMPWYKGPT 217          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1AS_PORPU (Elongation factor 1-alpha S OS=Porphyra purpurea GN=TEF-S PE=2 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 3.962e-67
Identity = 129/187 (68.98%), Postives = 149/187 (79.68%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPK----YSKARYDEIVKEVSSYLKKVGY 632
            MGKEKTHIN+VVIGHVD+GKSTTTGHLIYKLGGID R I +FE +A EM K SFKYAWVLDKLKAERERGITIDIALWKF T K+  TVIDAPGHRDFIKNMITGTSQAD A+L+ID     FEAGI++ G T+EHALLA+TLGVKQ+    NKMD    K    +++ RY+E+V  +   L K+G+
Sbjct:    1 MGKEKTHINLVVIGHVDAGKSTTTGHLIYKLGGIDARTIAKFEADAKEMGKSSFKYAWVLDKLKAERERGITIDIALWKFSTAKFEYTVIDAPGHRDFIKNMITGTSQADVALLVIDG--NNFEAGIAEGGSTKEHALLAYTLGVKQLAVGINKMDDVKDKDGGPWAQGRYNEVVDYLGPELMKIGF 185          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A2_EUPCR (Elongation factor 1-alpha 2 OS=Euplotes crassus GN=EFA2 PE=3 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 4.844e-65
Identity = 128/213 (60.09%), Postives = 160/213 (75.12%), Query Frame = 3
Query:   90 KEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPISGSRVTHD*E-VYHLDWYRGPT 725
            KEK H+N+VVIGHVDSGKSTTTGHLIYKLGGID+R + + E++A E+NK SFKYA+VLD LKAE+ERGITI+ AL +F+T     T+IDAPGH+DFIKNMITGTSQAD AVLII +  G FE G S++G T++HALLA+T+G+KQ I   NKMD  T  Y + R++EIV+ VS +L K+GY        PISG    +  E   +L WY+GPT
Sbjct:    4 KEKDHLNLVVIGHVDSGKSTTTGHLIYKLGGIDERTLAKLEEKALELNKASFKYAFVLDNLKAEQERGITINCALRQFDTPSRSYTIIDAPGHKDFIKNMITGTSQADAAVLIIAAKKGEFEDGFSREGSTKDHALLAYTMGIKQAIVAINKMD--TIDYDEERFNEIVENVSDHLGKIGYKKENVKYIPISGFDGDNMLEQSENLPWYKGPT 214          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_HYPBU (Elongation factor 1-alpha OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403) GN=tuf PE=3 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 6.326e-65
Identity = 118/217 (54.38%), Postives = 156/217 (71.89%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPIS---GSRVTHD*EVYHLDWYRGPT 725
            M ++K HIN+VVIGHVD GKST  GHL+Y+LG +D++ I+  E+EA +  K SFKYAW+LD+LK ERERG+TID+   KFET KYY T+IDAPGHRDF+KNMITG SQAD A+L++ +  G FEAG+S +GQTREH +LA T+G+ Q+I   NKMDAT P YSK RY++IV  +  ++K +GY   +    P+S   G  +       ++ WY GPT
Sbjct:    1 MSQQKPHINLVVIGHVDHGKSTLVGHLLYRLGFVDEKTIKMLEEEAKKKGKESFKYAWLLDRLKEERERGVTIDLTFVKFETKKYYFTIIDAPGHRDFVKNMITGASQADAAILVVSARRGEFEAGMSAEGQTREHLILAKTMGIDQLIVAVNKMDATEPPYSKQRYEQIVAFLKKFMKSLGYKVDQIPFIPVSAWTGENLIE--RSPNMPWYNGPT 215          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_IGNH4 (Elongation factor 1-alpha OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=tuf PE=3 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 2.404e-64
Identity = 117/215 (54.42%), Postives = 157/215 (73.02%), Query Frame = 3
Query:   90 KEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPIS---GSRVTHD*EVYHLDWYRGPT 725
            KEK H+N++VIGHVD GKST  GHL+Y+LG +D++ ++  E+EA +  K SFKYAW+LDKLK ERERG+TID+   KFET KYY T+IDAPGHRDFIKNMITG SQAD A+L++ +  G FEAG+S +GQTREH LLA T+G+ Q+I   NKMDAT P +S+ RY +IV+ +  ++K +G+   +    P+S   G  +    E  ++ WY+GPT
Sbjct:    4 KEKPHMNLIVIGHVDHGKSTLVGHLLYELGFVDEKTLKMLEEEAKKRGKESFKYAWLLDKLKEERERGVTIDLTFMKFETPKYYFTIIDAPGHRDFIKNMITGASQADAAILVVSARPGEFEAGMSAEGQTREHILLAKTMGIDQIIVAVNKMDATEPPWSEKRYKQIVETLKKFMKGLGFKVDEIPFVPVSAWTGDNIIKRSE--NMPWYKGPT 216          
BLAST of FC868498 vs. ExPASy Swiss-Prot
Match: EF1A_DESMO (Elongation factor 1-alpha OS=Desulfurococcus mobilis GN=tuf PE=3 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 2.035e-63
Identity = 114/214 (53.27%), Postives = 156/214 (72.90%), Query Frame = 3
Query:   93 EKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYTPRKSHSCPIS---GSRVTHD*EVYHLDWYRGPT 725
            +K H+NIV+IGHVD GKST TGH++Y+LG  D++ ++  E+E+ +M K SFK+AW+LD++K ERERG+TI ++  KFET KY+ T+IDAPGHRDF+KNMITG SQAD A+L++ +  G FEAG+S +GQTREHA+LA T+G+ Q+I   NKMDAT P YS+ RY+EI + +  +LK +GY   K    PIS   G  +       ++ WY GPT
Sbjct:    5 QKPHLNIVIIGHVDHGKSTMTGHILYRLGYFDEKTVKMIEEESKKMGKESFKFAWLLDRMKEERERGVTISLSYMKFETKKYFFTIIDAPGHRDFVKNMITGASQADAAILVVSARKGEFEAGMSAEGQTREHAILARTMGINQLIVAINKMDATEPPYSEKRYNEIKEILGKFLKGLGYDVSKIPFIPISAWTGENLIE--RSPNMPWYNGPT 216          
The following BLAST results are available for this feature:
BLAST of FC868498 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_ADIBE2.646e-7980.11Elongation factor 1-alpha (Fragment) OS=Adisura be... [more]
EF1A_STYLE1.896e-7769.30Elongation factor 1-alpha OS=Stylonychia lemnae GN... [more]
EF1A_CRYPV3.234e-7770.51Elongation factor 1-alpha OS=Cryptosporidium parvu... [more]
EF1A1_XENLA4.670e-7666.16Elongation factor 1-alpha OS=Xenopus laevis PE=1 S... [more]
EF1A_BLAHO2.318e-7566.36Elongation factor 1-alpha OS=Blastocystis hominis ... [more]
EF1AS_PORPU3.962e-6768.98Elongation factor 1-alpha S OS=Porphyra purpurea G... [more]
EF1A2_EUPCR4.844e-6560.09Elongation factor 1-alpha 2 OS=Euplotes crassus GN... [more]
EF1A_HYPBU6.326e-6554.38Elongation factor 1-alpha OS=Hyperthermus butylicu... [more]
EF1A_IGNH42.404e-6454.42Elongation factor 1-alpha OS=Ignicoccus hospitalis... [more]
EF1A_DESMO2.035e-6353.27Elongation factor 1-alpha OS=Desulfurococcus mobil... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31001B02EF AbioticL1 Citrus clementina cDNA clone C31001B02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868498 ID=FC868498|Name=FC868498|organism=Citrus clementina|type=EST|length=728bp
GACTCTTTGCCCTCCCTCTTTTCTTGCTTGCTCTGCGGCTAGGTTTCAAT
TGTCTCTTCGAAGTTTCAGTTAATTTAACAGCCATGGGTAAGGAGAAGAC
TCACATCAACATTGTGGTGATTGGCCATGTCGACTCTGGAAAGTCGACCA
CCACCGGACACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTGATC
GAGAGGTTCGAGAAGGAAGCTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACACCCCGAGAAAGTCCCAT
TCGTGCCCNATCTCTGGTTCGAGGGTGACACATGATTGAGAGGTCTACCA
CCTTGACTGGTACAGGGGTCCAACCTGC
back to top