FC868554

Overview
NameFC868554
Unique NameFC868554
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length666
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868554 vs. ExPASy Swiss-Prot
Match: PER5_ARATH (Peroxidase 5 OS=Arabidopsis thaliana GN=PER5 PE=2 SV=2)

HSP 1 Score: 120.553 bits (301), Expect = 7.567e-27
Identity = 67/180 (37.22%), Postives = 99/180 (55.00%), Query Frame = 2
Query:   56 FYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSF-GMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKS-RAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY 589
            FY  +C  A   I+  V+    R +  A S +R  FHDC V  CDAS+LL+ T    SE++   +F  +R F  I+  K  VE+ CPG+VSCADI+ ++ RD    +GGP   +K GRRD   + +A      LP   D++  +   F+  G++   LVAL G+H++G++ C     RLY
Sbjct:   30 FYDQSCRNALSKIRSSVRTAIARERRMAASLIRMHFHDCFVHGCDASILLEGTSTIESERDALPNFKSVRGFEVIDKAKSEVEKVCPGIVSCADIIAVAARDASEYVGGPKWAVKVGRRDSTAAFKALANSGELPGFKDTLDQLSGLFSKKGLNTRDLVALSGAHTIGQSQCFLFRDRLY 209          
BLAST of FC868554 vs. ExPASy Swiss-Prot
Match: PER66_MAIZE (Peroxidase 66 OS=Zea mays GN=PER66 PE=1 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.291e-26
Identity = 74/204 (36.27%), Postives = 102/204 (50.00%), Query Frame = 2
Query:   44 LVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALNPDHVPHMLHKCPDA 655
            L   FY  +CP A   I+  V    ++      S LR  FHDC V+ CDASLLL+ T    S+   + +   R F  + +IK  VE  CPG+VSCADIL ++ RDGVVALGGP   +  GRRD   S A      LP    S+  +L  +    ++   +VAL G+H++G+  C      +Y   D  +N      +   CP A
Sbjct:   31 LSSTFYDRSCPNALSTIRSGVNSAVRQEPRVGASLLRLHFHDCFVRGCDASLLLNDTSGEQSQGP-NLTLNPRGFVVVNSIKAQVESVCPGIVSCADILAVAARDGVVALGGPSWTVLLGRRDSTASFAGQTSD-LPPPTSSLGQLLSAYNKKNLNPTDMVALSGAHTIGQAQCSSFNDHIYN--DTNINSAFAASLRANCPRA 230          
BLAST of FC868554 vs. ExPASy Swiss-Prot
Match: PER32_ARATH (Peroxidase 32 OS=Arabidopsis thaliana GN=PER32 PE=1 SV=3)

HSP 1 Score: 119.783 bits (299), Expect = 1.291e-26
Identity = 76/222 (34.23%), Postives = 113/222 (50.90%), Query Frame = 2
Query:    5 LRSALASNEEDPGLVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEM-DRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPG-LVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLHKCP 649
            L S+++S +  P     FY +TCP    I+++ +    +     A S LR  FHDC V  CDAS+LLD+T    +EK+    +   R F  I+ +K AVE  CP  VSCADIL ++ +  V   GGP   +  GRRD  ++   +    LP    ++  +   F  +G+D P  LVAL G H+ G+  C  ++ RLY        DP LN  ++  +  +CP
Sbjct:   22 LHSSISSAQLTP----TFYDNTCPSVFTIVRDTIVNELRSDPRIAASILRLHFHDCFVNGCDASILLDNTTSFRTEKDAAPNANSARGFPVIDRMKAAVETACPRTVSCADILTIAAQQAVNLAGGPSWRVPLGRRDSLQAFFALANTNLPAPFFTLPQLKASFQNVGLDRPSDLVALSGGHTFGKNQCQFIMDRLYNFSNTGLPDPTLNTTYLQTLRGQCP 239          
BLAST of FC868554 vs. ExPASy Swiss-Prot
Match: PER70_ARATH (Peroxidase 70 OS=Arabidopsis thaliana GN=PER70 PE=2 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 2.202e-26
Identity = 75/203 (36.95%), Postives = 99/203 (48.77%), Query Frame = 2
Query:   56 FYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLHKCP 649
            +Y   C   E I++  V+  Y  +   A   LR  FHDC VQ CDAS+LL       SE+    +  +R F  IE  K  +E  CP  VSCADIL L+ RD V   GGP+ P+  GR DGR S A      LP   DS++V   RFA   ++   LV L   H++G   C+    R +        DP + P  VP +  +CP
Sbjct:   38 YYGSACWNVESIVRSVVESNYLANPANAPGILRMHFHDCFVQGCDASVLLAGPN---SERTAIPNLSLRGFNVIEEAKTQLEIACPRTVSCADILALAARDFVHLAGGPWWPVPLGRLDGRISLAS--NVILPGPTDSVAVQKLRFAEKNLNTQDLVVLAAGHTIGTAGCIVFRDRFFNYDNTGSPDPTIAPSFVPLIQAQCP 235          
BLAST of FC868554 vs. ExPASy Swiss-Prot
Match: PER73_ARATH (Peroxidase 73 OS=Arabidopsis thaliana GN=PER73 PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 2.875e-26
Identity = 73/214 (34.11%), Postives = 112/214 (52.34%), Query Frame = 2
Query:   44 LVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSFGMRN--FRYIENIKEAVER--ECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLHKCPDAI 658
            L  NFY ++CP  E I+K+ V+   K+   T  + LR  FHDC V  CDAS+++ ST    +EK+   +  +    F  +   K+A++    C   VSCADIL L+ RD VVA  GP   ++ GR DG  S A  +   LP  N+ ++ + + FA   +    ++AL  +H++G  HC K+ +R+Y       VDP LN  +   +   CP  +
Sbjct:   27 LKTNFYGNSCPNVEQIVKKVVQEKIKQTFVTIPATLRLFFHDCFVNGCDASVMIQSTPTNKAEKDHPDNISLAGDGFDVVIKAKKALDAIPSCKNKVSCADILALATRDVVVAAKGPSYAVELGRFDGLVSTAASVNGNLPGPNNKVTELNKLFAKNKLTQEDMIALSAAHTLGFAHCGKVFNRIYNFNLTHAVDPTLNKAYAKELQLACPKTV 240          
BLAST of FC868554 vs. ExPASy Swiss-Prot
Match: PER35_ARATH (Peroxidase 35 OS=Arabidopsis thaliana GN=PER35 PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 3.755e-26
Identity = 72/211 (34.12%), Postives = 107/211 (50.71%), Query Frame = 2
Query:   44 LVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSFGMRN--FRYIENIKEAVERE--CPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYP-----EVDPALNPDHVPHMLHKCP 649
            L   FY  TCP  E I++  V+   K+      + LR  FHDC V  CDAS+++ ST K  +EK+   +  +    F  +   K+A++    C   VSCADIL L+ RD VVA GGP   ++ GR DG  S A  +E  LP  +D++  +   F    +    ++AL  +H++G  HC K+  R++       VDP LN  +   +   CP
Sbjct:   27 LSRGFYSKTCPNVEQIVRNAVQKKIKKTFVAVPATLRLFFHDCFVNGCDASVMIQSTPKNKAEKDHPDNISLAGDGFDVVIQAKKALDSNPSCRNKVSCADILTLATRDVVVAAGGPSYEVELGRFDGLVSTASSVEGNLPGPSDNVDKLNALFTKNKLTQEDMIALSAAHTLGFAHCGKVFKRIHKFNGINSVDPTLNKAYAIELQKACP 237          
BLAST of FC868554 vs. ExPASy Swiss-Prot
Match: PER1A_ARMRU (Peroxidase C1A OS=Armoracia rusticana GN=PRXC1A PE=1 SV=2)

HSP 1 Score: 118.242 bits (295), Expect = 3.755e-26
Identity = 71/218 (32.57%), Postives = 112/218 (51.38%), Query Frame = 2
Query:   17 LASNEEDPGLVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKE-MDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGID-APGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLHKCP 649
            L ++  D  L   FY ++CP   +I+++ +    +     A S LR  FHDC V  CDAS+LLD+T    +EK+    +   R F  I+ +K AVE  CP  VSCAD+L ++ +  V   GGP   +  GRRD  ++  ++    LP    ++  + + F  +G++ +  LVAL G H+ G+  C  ++ RLY        DP LN  ++  +   CP
Sbjct:   23 LHASLSDAQLTPTFYDNSCPNVSNIVRDTIVNELRSDPRIAASILRLHFHDCFVNGCDASILLDNTTSFRTEKDAFGNANSARGFPVIDRMKAAVESACPRTVSCADLLTIAAQQSVTLAGGPSWRVPLGRRDSLQAFLDLANANLPAPFFTLPQLKDSFRNVGLNRSSDLVALSGGHTFGKNQCRFIMDRLYNFSNTGLPDPTLNTTYLQTLRGLCP 240          
BLAST of FC868554 vs. ExPASy Swiss-Prot
Match: PERX_TOBAC (Lignin-forming anionic peroxidase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 4.905e-26
Identity = 71/200 (35.50%), Postives = 103/200 (51.50%), Query Frame = 2
Query:   20 ASNEEDPGLVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALNPD 619
            ASN +   L   FY  TCP    I++  +    +         +R  FHDC V  CD S+LLD T  T +EK+   + G   F  +++IK A+E  CPGVVSCADIL L+   GVV   GP   +  GR+D   +        +P   ++++V++ +F   G+D   LVAL G+H+ GR  C     RL+   + + NPD
Sbjct:   19 ASNAQ---LSATFYDTTCPNVTSIVRGVMDQRQRTDARAGAKIIRLHFHDCFVNGCDGSILLD-TDGTQTEKDAPANVGAGGFDIVDDIKTALENVCPGVVSCADILALASEIGVVLAKGPSWQVLFGRKDSLTANRSGANSDIPSPFETLAVMIPQFTNKGMDLTDLVALSGAHTFGRARCGTFEQRLF-NFNGSGNPD 213          
BLAST of FC868554 vs. ExPASy Swiss-Prot
Match: PER69_ARATH (Peroxidase 69 OS=Arabidopsis thaliana GN=PER69 PE=1 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 4.152e-25
Identity = 73/205 (35.61%), Postives = 105/205 (51.22%), Query Frame = 2
Query:   50 MNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLHKCP 649
            + FY + C   E I++  V+   +     A   LR  FHDC V  CD S+LL       SE+    +  +R F  IE  K  +E+ CP  VSCADIL L+ RD VV  GG    +  GR DGR S+A   +  LP  +DS++   + FAA  ++   LV L+G H++G   C  +  R        + DP+++P  VP +L +CP
Sbjct:   39 VGFYGNRCRNVESIVRSVVQSHVRSIPANAPGILRMHFHDCFVHGCDGSVLLAGNT---SERTAVPNRSLRGFEVIEEAKARLEKACPRTVSCADILTLAARDAVVLTGGQRWEVPLGRLDGRISQAS--DVNLPGPSDSVAKQKQDFAAKTLNTLDLVTLVGGHTIGTAGCGLVRGRFVNFNGTGQPDPSIDPSFVPLILAQCP 238          
BLAST of FC868554 vs. ExPASy Swiss-Prot
Match: PER1_SORBI (Cationic peroxidase SPC4 (Fragment) OS=Sorghum bicolor PE=1 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 4.152e-25
Identity = 68/176 (38.64%), Postives = 101/176 (57.39%), Query Frame = 2
Query:   38 PGLVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSFGMR--NFRYIENIKEAVERECPG-VVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRK--SRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSV 550
            PGL  +FYK +CP+AE I++  V+   +R    A   LR  FHDC VQ CDAS+LLD +     E++   +  +R   F+ I +I + + +EC G VVSC+D+L L+ RD VV  GGP   +  GRRD     ++ ++L   LP    ++  +L   + I +DA  LVAL G H++
Sbjct:   39 PGLSFDFYKRSCPKAESIVRSFVQDAVRRDVGLAAGLLRLHFHDCFVQGCDASVLLDGSATGPGEQQAPPNLTLRPTAFKAINDIHDRLHKECGGTVVSCSDVLALAARDSVVVSGGPSYKVPLGRRDSASFATQQDVLSG-LPPPTAAVPALLAVLSKINLDATDLVALSGGHTI 213          
The following BLAST results are available for this feature:
BLAST of FC868554 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 108
Match NameE-valueIdentityDescription
PER5_ARATH7.567e-2737.22Peroxidase 5 OS=Arabidopsis thaliana GN=PER5 PE=2 ... [more]
PER66_MAIZE1.291e-2636.27Peroxidase 66 OS=Zea mays GN=PER66 PE=1 SV=1[more]
PER32_ARATH1.291e-2634.23Peroxidase 32 OS=Arabidopsis thaliana GN=PER32 PE=... [more]
PER70_ARATH2.202e-2636.95Peroxidase 70 OS=Arabidopsis thaliana GN=PER70 PE=... [more]
PER73_ARATH2.875e-2634.11Peroxidase 73 OS=Arabidopsis thaliana GN=PER73 PE=... [more]
PER35_ARATH3.755e-2634.12Peroxidase 35 OS=Arabidopsis thaliana GN=PER35 PE=... [more]
PER1A_ARMRU3.755e-2632.57Peroxidase C1A OS=Armoracia rusticana GN=PRXC1A PE... [more]
PERX_TOBAC4.905e-2635.50Lignin-forming anionic peroxidase OS=Nicotiana tab... [more]
PER69_ARATH4.152e-2535.61Peroxidase 69 OS=Arabidopsis thaliana GN=PER69 PE=... [more]
PER1_SORBI4.152e-2538.64Cationic peroxidase SPC4 (Fragment) OS=Sorghum bic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31001H01EF AbioticL1 Citrus clementina cDNA clone C31001H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868554 ID=FC868554; Name=FC868554; organism=Citrus clementina; type=EST; length=666bp
GTCTCTGAGGTCTGCTTTGGCATCAAATGAAGAGGACCCAGGTCTTGTTA
TGAATTTTTACAAGGATACATGCCCTCAGGCCGAGGACATTATCAAGGAA
CAAGTTAAGCTTCTGTACAAGCGCCACAAGAACACTGCATTTTCTTGGCT
TAGAAACATTTTCCATGACTGTGCTGTCCAGTCTTGTGATGCTTCACTGC
TTCTGGACTCGACAAGAAAGACCTTGTCTGAGAAGGAAATGGACAGGAGC
TTTGGTATGAGGAACTTCAGGTACATTGAGAACATCAAAGAAGCTGTTGA
AAGAGAGTGCCCTGGTGTTGTTTCCTGTGCTGATATTCTTGTCCTGTCCG
GTAGAGATGGCGTTGTTGCGCTTGGAGGCCCTTACATTCCTCTCAAGACA
GGAAGAAGAGATGGTAGAAAAAGCAGAGCAGAGATACTTGAGCAGTATCT
CCCAGATCACAATGACAGCATGTCTGTTGTTCTTGAGAGGTTTGCAGCCA
TTGGCATTGACGCCCCTGGACTTGTTGCTCTGCTAGGATCTCACAGTGTT
GGCAGAACTCATTGTGTGAAGCTGGTGCACCGTCTGTACCCAGAAGTTGA
CCCTGCACTGAACCCTGACCACGTTCCGCATATGCTCCATAAGTGTCCTG
ATGCAATCCCAGACCC
back to top