FC868754

Overview
NameFC868754
Unique NameFC868754
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length729
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14114 contig Ccv1_Contig14114:20..750. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALDOB_SHEEP (Fructose-bisphosphate aldolase B OS=Ovis aries GN=ALDOB PE=2 SV=2)

HSP 1 Score: 134.806 bits (338), Expect = 4.576e-31
Identity = 72/139 (51.80%), Postives = 91/139 (65.47%), Query Frame = 2
Query:  248 LVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPG-LGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            L +TA+ + + G+GILA DES  T G RL  I +ENTE NR+ +R LL T    + Q I G ILF ETLYQ    GK   D+L E+ IV GIK+D+G+ PLAG+N E+  QGLDGL+ R A Y + GA F KWR V+ I
Sbjct:   16 LSETARRIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFRELLFTVDSSVSQSIGGVILFHETLYQKDGQGKLFRDILKEKGIVVGIKLDQGVAPLAGTNKETTVQGLDGLSERCAQYKKDGADFGKWRAVLKI 154          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALDOB_BOVIN (Fructose-bisphosphate aldolase B OS=Bos taurus GN=ALDOB PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 4.576e-31
Identity = 72/139 (51.80%), Postives = 91/139 (65.47%), Query Frame = 2
Query:  248 LVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPG-LGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            L +TA+ + + G+GILA DES  T G RL  I +ENTE NR+ +R LL T    + Q I G ILF ETLYQ    GK   D+L E+ IV GIK+D+G+ PLAG+N E+  QGLDGL+ R A Y + GA F KWR V+ I
Sbjct:   16 LSETARRIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFRELLFTVDSSVSQSIGGVILFHETLYQKDGQGKLFRDILKEKGIVVGIKLDQGVAPLAGTNKETTVQGLDGLSERCAQYKKDGADFGKWRAVLKI 154          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALDOC_PANTR (Fructose-bisphosphate aldolase C OS=Pan troglodytes GN=ALDOC PE=2 SV=3)

HSP 1 Score: 134.42 bits (337), Expect = 5.976e-31
Identity = 72/153 (47.06%), Postives = 97/153 (63.40%), Query Frame = 2
Query:  206 PSSLTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPG-LGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            P S    +     EL   A  + +PG+GILA DES  +  KRL+ IG+ENTE NR+ YR +L +A   + + I G I F ETLYQ   +G   +  ++++ IV GIKVDKG+VPLAG++ E+  QGLDGL+ R A Y + GA FAKWR V+ I
Sbjct:    2 PHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFIRTILDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKI 154          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALDOC_MACFA (Fructose-bisphosphate aldolase C OS=Macaca fascicularis GN=ALDOC PE=2 SV=3)

HSP 1 Score: 133.65 bits (335), Expect = 1.019e-30
Identity = 73/153 (47.71%), Postives = 96/153 (62.75%), Query Frame = 2
Query:  206 PSSLTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPG-LGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            P S    +     EL   A  + +PG+GILA DES  +  KRL+ IG+ENTE NR+ YR +L +A   + + I G I F ETLYQ   +G   V  + ++ IV GIKVDKG+VPLAG++ E+  QGLDGL+ R A Y + GA FAKWR V+ I
Sbjct:    2 PHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKI 154          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALDOC_HUMAN (Fructose-bisphosphate aldolase C OS=Homo sapiens GN=ALDOC PE=1 SV=2)

HSP 1 Score: 133.65 bits (335), Expect = 1.019e-30
Identity = 73/153 (47.71%), Postives = 96/153 (62.75%), Query Frame = 2
Query:  206 PSSLTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPG-LGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            P S    +     EL   A  + +PG+GILA DES  +  KRL+ IG+ENTE NR+ YR +L +A   + + I G I F ETLYQ   +G   V  + ++ IV GIKVDKG+VPLAG++ E+  QGLDGL+ R A Y + GA FAKWR V+ I
Sbjct:    2 PHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKI 154          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALDOC_RAT (Fructose-bisphosphate aldolase C OS=Rattus norvegicus GN=Aldoc PE=1 SV=3)

HSP 1 Score: 132.88 bits (333), Expect = 1.739e-30
Identity = 73/153 (47.71%), Postives = 95/153 (62.09%), Query Frame = 2
Query:  206 PSSLTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPG-LGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            P S    +     EL   A  + +PG+GILA DES  +  KRL+ IG+ENTE NR+ YR +L +A   + + I G I F ETLYQ   +G   V  + E+ I+ GIKVDKG+VPLAG++ E+  QGLDGL  R A Y + GA FAKWR V+ I
Sbjct:    2 PHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQEKGILVGIKVDKGVVPLAGTDGETTTQGLDGLLERCAQYKKDGADFAKWRCVLKI 154          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALDOC_MOUSE (Fructose-bisphosphate aldolase C OS=Mus musculus GN=Aldoc PE=1 SV=4)

HSP 1 Score: 131.724 bits (330), Expect = 3.874e-30
Identity = 72/153 (47.06%), Postives = 95/153 (62.09%), Query Frame = 2
Query:  206 PSSLTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPG-LGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            P S    +     EL   A  + +PG+GILA DES  +  KRL+ IG+ENTE NR+ YR +L +A   + + I G I F ETLYQ   +G   V  + ++ I+ GIKVDKG+VPLAG++ E+  QGLDGL  R A Y + GA FAKWR V+ I
Sbjct:    2 PHSYPALSAEQKKELSDIALRIVTPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGILVGIKVDKGVVPLAGTDGETTTQGLDGLLERCAQYKKDGADFAKWRCVLKI 154          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALDOB_SPAAU (Fructose-bisphosphate aldolase B OS=Sparus aurata GN=aldob PE=2 SV=2)

HSP 1 Score: 129.798 bits (325), Expect = 1.472e-29
Identity = 67/140 (47.86%), Postives = 89/140 (63.57%), Query Frame = 2
Query:  245 ELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLV-TAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            EL   A+ + +PG+GILA DES  T GKR  +I +EN E NR+ +R +L  T   +   + G I F ETLYQ +++GK    V+ E+ IV GIKVDKG  PL G++ E+  QGLDGL+ R A Y + G  FAKWR V+ I
Sbjct:   15 ELSDIAQRIVAPGKGILAADESTGTMGKRFQNINVENIEENRRCFRDILFSTDASIANCVGGIIFFHETLYQKSSNGKLFPQVVKEKGIVVGIKVDKGTAPLMGTDKETTTQGLDGLSERCAQYKKDGCDFAKWRCVLKI 154          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALDOB_RAT (Fructose-bisphosphate aldolase B OS=Rattus norvegicus GN=Aldob PE=1 SV=2)

HSP 1 Score: 128.257 bits (321), Expect = 3.724e-29
Identity = 69/140 (49.29%), Postives = 90/140 (64.29%), Query Frame = 2
Query:  245 ELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPG-LGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            EL + A+ + + G+GILA DES  T G RL  I +ENTE NR+ +R LL +    + Q I G ILF ETLYQ  + GK   ++L E+ IV GIK+D+G  PLAG+N E+  QGLDGL+ R A Y + G  F KWR V+ I
Sbjct:   15 ELSEIAQRIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFRELLFSVDNSISQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRI 154          

HSP 2 Score: 21.1718 bits (43), Expect = 3.724e-29
Identity = 11/19 (57.89%), Postives = 12/19 (63.16%), Query Frame = 3
Query:  669 PICLGSQEAAWGLARYAAI 725
            P  L  QE A  LARYA+I
Sbjct:  159 PSSLAIQENANALARYASI 177          
BLAST of FC868754 vs. ExPASy Swiss-Prot
Match: ALDOB_PONAB (Fructose-bisphosphate aldolase B OS=Pongo abelii GN=ALDOB PE=2 SV=3)

HSP 1 Score: 128.257 bits (321), Expect = 3.724e-29
Identity = 68/140 (48.57%), Postives = 91/140 (65.00%), Query Frame = 2
Query:  245 ELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPG-LGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            EL + A+++ + G+GILA DES  T G RL  I +ENTE NR+ +R +L +    + Q I G ILF ETLYQ  + GK   ++L E+ IV GIK+D+G  PLAG+N E+  QGLDGL+ R A Y + G  F KWR V+ I
Sbjct:   15 ELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFREILFSVDSSINQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRI 154          

HSP 2 Score: 21.1718 bits (43), Expect = 3.724e-29
Identity = 11/19 (57.89%), Postives = 12/19 (63.16%), Query Frame = 3
Query:  669 PICLGSQEAAWGLARYAAI 725
            P  L  QE A  LARYA+I
Sbjct:  159 PSSLAIQENANALARYASI 177          
The following BLAST results are available for this feature:
BLAST of FC868754 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
ALDOB_SHEEP4.576e-3151.80Fructose-bisphosphate aldolase B OS=Ovis aries GN=... [more]
ALDOB_BOVIN4.576e-3151.80Fructose-bisphosphate aldolase B OS=Bos taurus GN=... [more]
ALDOC_PANTR5.976e-3147.06Fructose-bisphosphate aldolase C OS=Pan troglodyte... [more]
ALDOC_MACFA1.019e-3047.71Fructose-bisphosphate aldolase C OS=Macaca fascicu... [more]
ALDOC_HUMAN1.019e-3047.71Fructose-bisphosphate aldolase C OS=Homo sapiens G... [more]
ALDOC_RAT1.739e-3047.71Fructose-bisphosphate aldolase C OS=Rattus norvegi... [more]
ALDOC_MOUSE3.874e-3047.06Fructose-bisphosphate aldolase C OS=Mus musculus G... [more]
ALDOB_SPAAU1.472e-2947.86Fructose-bisphosphate aldolase B OS=Sparus aurata ... [more]
ALDOB_RAT3.724e-2949.29Fructose-bisphosphate aldolase B OS=Rattus norvegi... [more]
ALDOB_PONAB3.724e-2948.57Fructose-bisphosphate aldolase B OS=Pongo abelii G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31004D04EF AbioticL1 Citrus clementina cDNA clone C31004D04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868754 ID=FC868754|Name=FC868754|organism=Citrus clementina|type=EST|length=729bp
AAAGATAGTGCAGATAAGATTATAAGTGCTATAAGCTAAGGCCTCTCGAG
CTCAGAACCCACAGCAAGAAGAAGCAAAGAGGAAAATGGCCTCAGCCTCG
GCATCTTTACTCAAGTCATCATCCCCCGTTCTTGACAAGTCTGAGTGGGT
TAAGGGCCAGGCCATCCGCCAGTCTACTGTCTCAGTCCGCAGCCTCCCCA
GTGGCCCCTCTTCCCTCACCATCCGTGCTGGTTCCTATGCCGATGAGCTT
GTCAAGACCGCGAAAACTGTTGCATCACCAGGACGTGGAATTTTGGCCAT
GGATGAGTCAAATGCAACTTGTGGAAAACGCCTTGCCTCAATTGGGTTAG
AGAACACTGAGGCTAACCGCCAGGCATACCGTACCCTCCTTGTTACAGCC
CCTGGTCTTGGACAGTACATCTCTGGTGCCATCCTTTTTGAGGAGACTCT
CTACCAATCCACCACCGATGGCAAGAAGATGGTCGATGTTCTTGTTGAGC
AAAACATTGTCCCCGGTATCAAAGTCGACAAGGGTTTGGTGCCCCTTGCT
GGTTCCAATGATGAGTCATGGTGCCAGGGTCTTGATGGCCTGGCTTCTCG
CACTGCTGCTTACTACCAACAGGGAGCTCGTTTCGCCAAATGGCGTACTG
TTGTGAGCATTCCCATGGCCCATCTGCCTTGGCAGTCAGGAAGCCGCCTG
GGGTCTTGCCCGCTATGCTGCCATTGCTC
back to top