FC868976

Overview
NameFC868976
Unique NameFC868976
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length712
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868976 vs. ExPASy Swiss-Prot
Match: ALF2_CAEEL (Fructose-bisphosphate aldolase 2 OS=Caenorhabditis elegans GN=aldo-2 PE=1 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 5.922e-33
Identity = 72/124 (58.06%), Postives = 87/124 (70.16%), Query Frame = 3
Query:  243 DELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAY 614
            DEL + A  +   G+GILA DES  T GKRL +I LEN E NRQ YR LL T P L Q+ISG IL+EET +QST  G+K  D+L++Q IVPGIK+D G+VPLAG+  E   QGLD LA R AA+
Sbjct:   18 DELHQIALKIVQDGKGILAADESTGTIGKRLDAINLENNETNRQKYRQLLFTTPNLNQHISGVILYEETFHQSTDKGEKFTDLLIKQGIVPGIKLDLGVVPLAGTIGEGTTQGLDKLAERAAAF 141          

HSP 2 Score: 21.557 bits (44), Expect = 5.922e-33
Identity = 8/13 (61.54%), Postives = 10/13 (76.92%), Query Frame = 2
Query:  623 GARFAKWRTVVSI 661
            G  FAKWR V++I
Sbjct:  145 GCGFAKWRCVLNI 157          
BLAST of FC868976 vs. ExPASy Swiss-Prot
Match: ALF_PLAFA (Fructose-bisphosphate aldolase OS=Plasmodium falciparum PE=1 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 1.082e-31
Identity = 69/126 (54.76%), Postives = 86/126 (68.25%), Query Frame = 3
Query:  240 ADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYY 617
            A+EL  TA+ +   G+GILA DES  T  KR  +I LENT  NR +YR LL    GLG++ISGAILFEETL+Q    G  MV++L  +NI+PGIKVDKGLV +  +++E   QGLDGLA R   YY
Sbjct:   19 AEELATTAQKLVQAGKGILAADESTQTIKKRFDNIKLENTIENRASYRDLLFGTKGLGKFISGAILFEETLFQKNEAGVPMVNLLHNENIIPGIKVDKGLVNIPCTDEEKSTQGLDGLAERCKEYY 144          

HSP 2 Score: 27.7202 bits (60), Expect = 1.082e-31
Identity = 12/16 (75.00%), Postives = 13/16 (81.25%), Query Frame = 2
Query:  623 GARFAKWRTVVSIPMA 670
            GARFAKWRTV+ I  A
Sbjct:  147 GARFAKWRTVLVIDTA 162          
BLAST of FC868976 vs. ExPASy Swiss-Prot
Match: ALF_PLAF7 (Fructose-bisphosphate aldolase OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0425 PE=3 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 1.082e-31
Identity = 69/126 (54.76%), Postives = 86/126 (68.25%), Query Frame = 3
Query:  240 ADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYY 617
            A+EL  TA+ +   G+GILA DES  T  KR  +I LENT  NR +YR LL    GLG++ISGAILFEETL+Q    G  MV++L  +NI+PGIKVDKGLV +  +++E   QGLDGLA R   YY
Sbjct:   19 AEELATTAQKLVQAGKGILAADESTQTIKKRFDNIKLENTIENRASYRDLLFGTKGLGKFISGAILFEETLFQKNEAGVPMVNLLHNENIIPGIKVDKGLVNIPCTDEEKSTQGLDGLAERCKEYY 144          

HSP 2 Score: 27.7202 bits (60), Expect = 1.082e-31
Identity = 12/16 (75.00%), Postives = 13/16 (81.25%), Query Frame = 2
Query:  623 GARFAKWRTVVSIPMA 670
            GARFAKWRTV+ I  A
Sbjct:  147 GARFAKWRTVLVIDTA 162          
BLAST of FC868976 vs. ExPASy Swiss-Prot
Match: ALF1_CAEEL (Fructose-bisphosphate aldolase 1 OS=Caenorhabditis elegans GN=aldo-1 PE=1 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 1.082e-31
Identity = 72/125 (57.60%), Postives = 85/125 (68.00%), Query Frame = 3
Query:  243 DELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPG-LGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAY 614
            DEL   A  + +PG+GILA DES  +  KRL SIGLENTE NR+ YR LL TA   L +YISG I+F ET YQ T DGK    +L EQ I+PGIKVDKG+VP+AG+  E   QGLD L +R A Y
Sbjct:   14 DELRSIANAIVTPGKGILAADESTGSMDKRLNSIGLENTEENRRKYRQLLFTAGADLNKYISGVIMFHETFYQKTDDGKPFTALLQEQGIIPGIKVDKGVVPMAGTIGEGTTQGLDDLNARCAQY 138          

HSP 2 Score: 22.3274 bits (46), Expect = 1.082e-31
Identity = 9/13 (69.23%), Postives = 10/13 (76.92%), Query Frame = 2
Query:  623 GARFAKWRTVVSI 661
            GA+FAKWR V  I
Sbjct:  142 GAQFAKWRCVHKI 154          
BLAST of FC868976 vs. ExPASy Swiss-Prot
Match: ALF1_XYLFT (Probable fructose-bisphosphate aldolase class 1 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=PD_1845 PE=3 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 1.084e-31
Identity = 65/125 (52.00%), Postives = 85/125 (68.00%), Query Frame = 3
Query:  243 DELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYY 617
            ++L +TA+ + + G+GI+A+DES  T  KR +S+G+EN E NR+AYR LL+T P L  YISGAILF+ET+ QST  G      + E  I+PGIKVDKG  PLAG   E   +GLDGL +R   YY
Sbjct:    4 EQLAETAQAMVASGKGIIAIDESAGTIAKRFSSVGIENIEENRRAYRELLLTTPKLSDYISGAILFDETIRQSTKAGVPFPKYMAEHGIIPGIKVDKGAYPLAGCPGELVTEGLDGLRARLEEYY 128          

HSP 2 Score: 26.9498 bits (58), Expect = 1.084e-31
Identity = 10/13 (76.92%), Postives = 12/13 (92.31%), Query Frame = 2
Query:  623 GARFAKWRTVVSI 661
            GARFAKWR V++I
Sbjct:  131 GARFAKWRAVINI 143          
BLAST of FC868976 vs. ExPASy Swiss-Prot
Match: ALF1_XYLFA (Probable fructose-bisphosphate aldolase class 1 OS=Xylella fastidiosa GN=XF_0826 PE=3 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 2.393e-31
Identity = 64/125 (51.20%), Postives = 85/125 (68.00%), Query Frame = 3
Query:  243 DELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYY 617
            ++L +TA+ + + G+GI+A+DES  T  KR +S+G+EN E NR+AYR LL+T P L  YISGAILF+ET+ QST  G      + +  I+PGIKVDKG  PLAG   E   +GLDGL +R   YY
Sbjct:    4 EQLAETAQAMVASGKGIIAIDESAGTIAKRFSSVGIENIEENRRAYRELLLTTPKLSDYISGAILFDETIRQSTKAGVPFPKYMADHGIIPGIKVDKGAYPLAGCPGELVTEGLDGLRARLEEYY 128          

HSP 2 Score: 26.9498 bits (58), Expect = 2.393e-31
Identity = 10/13 (76.92%), Postives = 12/13 (92.31%), Query Frame = 2
Query:  623 GARFAKWRTVVSI 661
            GARFAKWR V++I
Sbjct:  131 GARFAKWRAVINI 143          
BLAST of FC868976 vs. ExPASy Swiss-Prot
Match: ALF2_PLABA (Fructose-bisphosphate aldolase 2 OS=Plasmodium berghei (strain Anka) GN=ALDO2 PE=3 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 3.113e-31
Identity = 68/126 (53.97%), Postives = 87/126 (69.05%), Query Frame = 3
Query:  240 ADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYY 617
            A EL +TAK + + G+GILA DES  T  KR  +I +ENT  NR +YR LL    GLG++ISGAILFEETL+Q    G  +V++L ++ I+PGIKVDKGLV +  ++DE   QGLDGLA R   YY
Sbjct:    8 AQELAETAKKLVAAGKGILAADESTQTIKKRFDNIKIENTVQNRASYRDLLFGTKGLGKFISGAILFEETLFQKNEAGVPLVNLLHDEGIIPGIKVDKGLVSIPCTDDEKSTQGLDGLAERCKEYY 133          

HSP 2 Score: 25.409 bits (54), Expect = 3.113e-31
Identity = 11/16 (68.75%), Postives = 12/16 (75.00%), Query Frame = 2
Query:  623 GARFAKWRTVVSIPMA 670
            GARFAKWR V+ I  A
Sbjct:  136 GARFAKWRAVLVIDPA 151          
BLAST of FC868976 vs. ExPASy Swiss-Prot
Match: ALF_DROME (Fructose-bisphosphate aldolase OS=Drosophila melanogaster GN=Ald PE=1 SV=5)

HSP 1 Score: 134.806 bits (338), Expect = 4.053e-31
Identity = 72/125 (57.60%), Postives = 87/125 (69.60%), Query Frame = 3
Query:  243 DELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLV-TAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAY 614
            DEL + A+ + +PG+GILA DES  T GKRL  IG+ENTE NR+AYR LL  T P L + ISG ILF ETLYQ   DG    ++L ++ I+ GIKVDKG+VPL GS DE   QGLD LA+R A Y
Sbjct:   14 DELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYRQLLFSTDPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQY 138          

HSP 2 Score: 21.1718 bits (43), Expect = 4.053e-31
Identity = 8/13 (61.54%), Postives = 9/13 (69.23%), Query Frame = 2
Query:  623 GARFAKWRTVVSI 661
            G  FAKWR V+ I
Sbjct:  142 GCDFAKWRCVLKI 154          
BLAST of FC868976 vs. ExPASy Swiss-Prot
Match: ALF2_LAMJA (Fructose-bisphosphate aldolase, non-muscle type OS=Lampetra japonica PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 6.107e-29
Identity = 66/124 (53.23%), Postives = 86/124 (69.35%), Query Frame = 3
Query:  246 ELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTA-PGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAY 614
            EL + A+ + S G+GILA DES  T GKRL++I +EN + NR+ YR LL ++ P + + I G I +EETLYQ T DG   V ++ ++ IV GIKVDKG VPLAG++ ES  QGLDGLA R A Y
Sbjct:   15 ELAEIAQRIVSNGKGILAADESTGTMGKRLSAIKVENVDENRRVYRQLLFSSDPSVTKAIGGVIFYEETLYQKTDDGTPFVKLIKDRGIVVGIKVDKGTVPLAGTDGESTTQGLDGLAERCARY 138          

HSP 2 Score: 22.7126 bits (47), Expect = 6.107e-29
Identity = 9/13 (69.23%), Postives = 10/13 (76.92%), Query Frame = 2
Query:  623 GARFAKWRTVVSI 661
            GA FAKWR V+ I
Sbjct:  142 GADFAKWRCVLKI 154          
BLAST of FC868976 vs. ExPASy Swiss-Prot
Match: ALDCB_DANRE (Fructose-bisphosphate aldolase C-B OS=Danio rerio GN=aldocb PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.348e-28
Identity = 65/124 (52.42%), Postives = 84/124 (67.74%), Query Frame = 3
Query:  246 ELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPG-LGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAY 614
            EL   A+ + +PG+GILA DES  +  KRL  IG+ENTE NR+ YR LL +A   + + I G I F ETLYQ+T DG     ++ ++ IV GIKVDKG+VPLAG+N E+  QGLDGL+ R A Y
Sbjct:   15 ELQDIAQRIVAPGKGILAADESTGSMAKRLNPIGVENTEENRRLYRQLLFSADERIDKCIGGVIFFHETLYQNTDDGTNFAQLIKDRGIVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQY 138          

HSP 2 Score: 23.483 bits (49), Expect = 1.348e-28
Identity = 9/13 (69.23%), Postives = 11/13 (84.62%), Query Frame = 2
Query:  623 GARFAKWRTVVSI 661
            GA FAKWR+V+ I
Sbjct:  142 GADFAKWRSVLKI 154          
The following BLAST results are available for this feature:
BLAST of FC868976 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
ALF2_CAEEL5.922e-3358.06Fructose-bisphosphate aldolase 2 OS=Caenorhabditis... [more]
ALF_PLAFA1.082e-3154.76Fructose-bisphosphate aldolase OS=Plasmodium falci... [more]
ALF_PLAF71.082e-3154.76Fructose-bisphosphate aldolase OS=Plasmodium falci... [more]
ALF1_CAEEL1.082e-3157.60Fructose-bisphosphate aldolase 1 OS=Caenorhabditis... [more]
ALF1_XYLFT1.084e-3152.00Probable fructose-bisphosphate aldolase class 1 OS... [more]
ALF1_XYLFA2.393e-3151.20Probable fructose-bisphosphate aldolase class 1 OS... [more]
ALF2_PLABA3.113e-3153.97Fructose-bisphosphate aldolase 2 OS=Plasmodium ber... [more]
ALF_DROME4.053e-3157.60Fructose-bisphosphate aldolase OS=Drosophila melan... [more]
ALF2_LAMJA6.107e-2953.23Fructose-bisphosphate aldolase, non-muscle type OS... [more]
ALDCB_DANRE1.348e-2852.42Fructose-bisphosphate aldolase C-B OS=Danio rerio ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31007B11EF AbioticL1 Citrus clementina cDNA clone C31007B11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868976 ID=FC868976; Name=FC868976; organism=Citrus clementina; type=EST; length=712bp
GAAAGATCGTGAAGATAAGATTATAAGTGCTATAAGCTAAGGCCTCTCGA
GCTCAGAACCCACAGCAAGAAGAAGCAAAGAGGAAAATGGCCTCAGCCTC
GGCATCTTTACTCAAGTCATCATCCCCCGTTCTTGACAAGTCTGAGTGGG
TTAAGGGCCAGGCCATCCGCCAGTCTACTGTCTCAGTCCGCAGCCTCCCC
AGTGGCCCCTCTTCCCTCACCATCCGTGCTGGTTCCTATGCCGATGAGCT
TGTCAAGACCGCGAAAACTGTTGCATCACCAGGACGTGGAATTTTGGCCA
TGGATGAGTCAAATGCAACTTGTGGAAAACGCCTTGCCTCAATTGGGTTA
GAGAACACTGAGGCTAACCGCCAGGCATACCGTACCCTCCTTGTTACAGC
CCCTGGTCTTGGACAGTACATCTCTGGTGCCATCCTTTTTGAGGAGACTC
TCTACCAATCCACCACCGATGGCAAGAAGATGGTCGATGTTCTTGTTGAG
CAAAACATTGTCCCCGGTATCAAAGTCGACAAGGGTTTGGTGCCCCTTGC
TGGTTCCAATGATGAGTCATGGTGCCAGGGTCTTGATGGCCTGGCTTCTC
GCACTGCTGCTTACTACCACAGGGAGCTCGTTTCGCCAAATGGCGTACTG
TTGTGAGCATTCCCATGGCCCATCTGCCTTGGCAGTCAAGGAAGCGCCCT
GGGTCTTGCCGC
back to top