FC869212

Overview
NameFC869212
Unique NameFC869212
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length401
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10231 contig Ccv1_Contig10231:291..691. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: DNAK_RHOPT (Chaperone protein dnaK OS=Rhodopseudomonas palustris (strain TIE-1) GN=dnaK PE=2 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 4.420e-48
Identity = 90/133 (67.67%), Postives = 108/133 (81.20%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            GK+ KVIEN+EG RTTPS+VA    GE LVG PAKRQA TNP  T F  KRLIGR++DDP  +++  +V YKIV+A NGDAWVEA+G+ YSPSQ+ AF+L KMKETAE++LG+ V +AVITVPAYFNDAQRQA
Sbjct:   21 GKSAKVIENAEGMRTTPSIVAITDDGERLVGQPAKRQAVTNPERTFFAVKRLIGRRYDDPMVEKDKGLVPYKIVKASNGDAWVEADGKTYSPSQVSAFILQKMKETAEAHLGQKVDQAVITVPAYFNDAQRQA 153          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: DNAK_RHOPA (Chaperone protein dnaK OS=Rhodopseudomonas palustris GN=dnaK PE=2 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 4.420e-48
Identity = 90/133 (67.67%), Postives = 108/133 (81.20%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            GK+ KVIEN+EG RTTPS+VA    GE LVG PAKRQA TNP  T F  KRLIGR++DDP  +++  +V YKIV+A NGDAWVEA+G+ YSPSQ+ AF+L KMKETAE++LG+ V +AVITVPAYFNDAQRQA
Sbjct:   21 GKSAKVIENAEGMRTTPSIVAITDDGERLVGQPAKRQAVTNPERTFFAVKRLIGRRYDDPMVEKDKGLVPYKIVKASNGDAWVEADGKTYSPSQVSAFILQKMKETAEAHLGQKVDQAVITVPAYFNDAQRQA 153          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: DNAK_MAGSM (Chaperone protein dnaK OS=Magnetococcus sp. (strain MC-1) GN=dnaK PE=2 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 4.420e-48
Identity = 93/133 (69.92%), Postives = 109/133 (81.95%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            G  PKVIENSEG RTTPS+VAF  +GE LVG  AKRQA TNPTNTL+  KRLIGR+F DP T ++  +V YKIV+A NGDAWVEA+G++ SPS+  A +L KMK+TAE YLG+SVS+AVITVPAYFNDAQRQA
Sbjct:   21 GGEPKVIENSEGVRTTPSMVAFTNQGERLVGQAAKRQAVTNPTNTLYAIKRLIGRRFSDPLTAKDQGLVPYKIVKADNGDAWVEADGKKMSPSECSAMILQKMKQTAEDYLGESVSEAVITVPAYFNDAQRQA 153          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: DNAK_CAUCR (Chaperone protein dnaK OS=Caulobacter crescentus GN=dnaK PE=2 SV=2)

HSP 1 Score: 189.119 bits (479), Expect = 5.773e-48
Identity = 90/133 (67.67%), Postives = 109/133 (81.95%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            GK PKVIEN+EG+RTTPSVVAF + GE L+G PAKRQA TNPTNTLF  KRLIGR   DP  +++  MV Y+IV+ P GDAWV+A+G+ YSP ++ AF+L KMKE AE++LG+ V+KAVITVPAYFNDAQRQA
Sbjct:   21 GKTPKVIENAEGARTTPSVVAFLEDGERLIGQPAKRQAVTNPTNTLFAIKRLIGRTASDPVVEKDKGMVPYEIVKGPTGDAWVKAHGKDYSPQEVSAFILQKMKEAAEAHLGEPVTKAVITVPAYFNDAQRQA 153          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: DNAK_OLICO (Chaperone protein dnaK OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=dnaK PE=2 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 9.847e-48
Identity = 90/133 (67.67%), Postives = 108/133 (81.20%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            GK+P+VIEN+EG RTTPS+VA     E LVG PAKRQA TNP  T+F  KRLIGR++DDP   ++  +V YKIV+A NGDAWVEA+G+ YSPSQI AF+L KMKETAE++LG+ V +AVITVPAYFNDAQRQA
Sbjct:   21 GKSPRVIENAEGMRTTPSIVALTDDDERLVGQPAKRQAVTNPEKTIFAVKRLIGRRYDDPTVAKDKDLVPYKIVKASNGDAWVEADGKIYSPSQISAFILQKMKETAEAHLGQKVDQAVITVPAYFNDAQRQA 153          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: DNAK_GRABC (Chaperone protein dnaK OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=dnaK PE=2 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 9.847e-48
Identity = 88/133 (66.17%), Postives = 111/133 (83.46%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            GK+ +V+EN+EG+RTTPS++AF   GE LVG  AKRQA TNP+NTL+  KRLIGR++DDP   ++  +V Y IVR  NGDAWVEA G++Y+PSQI AFVL+KMKETAE+YLG+ V++AVITVPAYFND+QRQA
Sbjct:   21 GKDVRVLENAEGARTTPSMIAFTDSGERLVGQAAKRQAVTNPSNTLYAVKRLIGRRYDDPTVAKDKDLVPYAIVRGDNGDAWVEARGEKYAPSQISAFVLSKMKETAEAYLGEPVTQAVITVPAYFNDSQRQA 153          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: DNAK_RHILE (Chaperone protein dnaK OS=Rhizobium leguminosarum GN=dnaK PE=2 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 1.286e-47
Identity = 89/130 (68.46%), Postives = 108/130 (83.08%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQ 391
            GK+ KVIEN+EG+RTTPS+VAF+  GE LVG PAKRQA TNPTNTLF  KRLIGR+++DP  +++  +V + IV+  NGDAWVEANG+ YSP+QI A +L KMKETAESYLG+ V KAVITVPAYFNDA+
Sbjct:   21 GKDAKVIENAEGARTTPSMVAFSDDGERLVGQPAKRQAVTNPTNTLFAVKRLIGRRYEDPTVEKDKHLVPFTIVKGDNGDAWVEANGKGYSPAQISAMILQKMKETAESYLGEKVEKAVITVPAYFNDAR 150          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: HSP7M_SCHPO (Heat shock 70 kDa protein, mitochondrial OS=Schizosaccharomyces pombe GN=ssp1 PE=2 SV=2)

HSP 1 Score: 187.578 bits (475), Expect = 1.680e-47
Identity = 89/133 (66.92%), Postives = 107/133 (80.45%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            G+ PKVI N+EG+RTTPSVVAF + GE LVG  AKRQA  NP NT F TKRLIGR+F +P+ QR+++ V YKIV   NGDAW+EA G+ YSPSQIG F+L+KM+ETA +YLGK V  AV+TVPAYFND+QRQA
Sbjct:   69 GQTPKVIANAEGTRTTPSVVAFTKDGERLVGVSAKRQAVINPENTFFATKRLIGRRFKEPEVQRDIKEVPYKIVEHSNGDAWLEARGKTYSPSQIGGFILSKMRETASTYLGKDVKNAVVTVPAYFNDSQRQA 201          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: DNAK_GLUDA (Chaperone protein dnaK OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=dnaK PE=2 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 2.194e-47
Identity = 91/133 (68.42%), Postives = 107/133 (80.45%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            G   +VIENSEG+RTTPS+VAF   GE+LVG  AKRQA TNP NTL+  KRLIGR++DDP   ++  +V Y IV   NGDAWVEA G++Y+PSQI AFVL KMKETAE+YLG+ VS+AVITVPAYFNDAQRQA
Sbjct:   21 GDETRVIENSEGARTTPSMVAFADNGEMLVGQSAKRQAVTNPANTLYAVKRLIGRRYDDPTVTKDKALVPYSIVAGDNGDAWVEAQGKKYAPSQIAAFVLGKMKETAEAYLGEPVSQAVITVPAYFNDAQRQA 153          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: DNAK_SILPO (Chaperone protein dnaK OS=Silicibacter pomeroyi GN=dnaK PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 3.742e-47
Identity = 92/133 (69.17%), Postives = 109/133 (81.95%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            G  PKVIENSEG+RTTPS+VAF  + E LVG PAKRQA TNP+NT+FG KRLIGR+ DD +  ++ +MV + IV   NGDAWVEA G++YSPSQI A +L KMKETAESYLG+ V++AVITVPAYFNDAQRQA
Sbjct:   21 GAQPKVIENSEGARTTPSIVAFTDE-ERLVGQPAKRQAVTNPSNTIFGVKRLIGRRVDDAEVTKDKKMVPFTIVNGGNGDAWVEAKGEKYSPSQISAVILGKMKETAESYLGEEVTQAVITVPAYFNDAQRQA 152          
The following BLAST results are available for this feature:
BLAST of FC869212 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
DNAK_RHOPT4.420e-4867.67Chaperone protein dnaK OS=Rhodopseudomonas palustr... [more]
DNAK_RHOPA4.420e-4867.67Chaperone protein dnaK OS=Rhodopseudomonas palustr... [more]
DNAK_MAGSM4.420e-4869.92Chaperone protein dnaK OS=Magnetococcus sp. (strai... [more]
DNAK_CAUCR5.773e-4867.67Chaperone protein dnaK OS=Caulobacter crescentus G... [more]
DNAK_OLICO9.847e-4867.67Chaperone protein dnaK OS=Oligotropha carboxidovor... [more]
DNAK_GRABC9.847e-4866.17Chaperone protein dnaK OS=Granulibacter bethesdens... [more]
DNAK_RHILE1.286e-4768.46Chaperone protein dnaK OS=Rhizobium leguminosarum ... [more]
HSP7M_SCHPO1.680e-4766.92Heat shock 70 kDa protein, mitochondrial OS=Schizo... [more]
DNAK_GLUDA2.194e-4768.42Chaperone protein dnaK OS=Gluconacetobacter diazot... [more]
DNAK_SILPO3.742e-4769.17Chaperone protein dnaK OS=Silicibacter pomeroyi GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31009G02EF AbioticL1 Citrus clementina cDNA clone C31009G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869212 ID=FC869212; Name=FC869212; organism=Citrus clementina; type=EST; length=401bp
GGGAAAGAACCCCAAAGTTATTGAGAACTCCGAAGGATCTAGGACTACAC
CATCAGTTGTAGCTTTCAATCAGAAGGGAGAGCTACTTGTGGGTACACCA
GCAAAGCGTCAGGCTGCGACCAACCCGACTAACACGCTCTTTGGCACCAA
GCGTTTAATTGGTAGAAAATTTGATGATCCCCAGACGCAAAGAGAAATGC
AGATGGTTTCATATAAGATAGTAAGGGCCCCCAATGGGGATGCTTGGGTT
GAAGCCAATGGGCAGCAGTACTCGCCAAGTCAGATTGGGGCCTTTGTTCT
GACCAAGATGAAAGAAACTGCAGAATCCTACCTTGGAAAGTCAGTTTCAA
AAGCAGTAATCACAGTTCCAGCTTATTTCAACGATGCTCAAAGGCAAGCT
A
back to top