FC875481

Overview
NameFC875481
Unique NameFC875481
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length703
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:223..925. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP72_MOUSE (Heat shock-related 70 kDa protein 2 OS=Mus musculus GN=Hspa2 PE=1 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 5.749e-100
Identity = 181/234 (77.35%), Postives = 203/234 (86.75%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNPTNT+FD KRLIGR+F DA+VQ DMK WPF+V++    KP + V YKGE K F  EEISSMVL KM+EIAEAYLG  +++AV+TVPAYFNDSQRQATKDAG I GLNV+RIINEPTAAAIAYGLDKK  + GEKNVLIFDLGGGTFDVS+LTIE+GIFE+K+TAGDTHLGGEDFDNRMV+H  +EFKRK + DI  N RA+RRLRTA
Sbjct:   37 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDRKRLIGRKFEDATVQSDMKHWPFRVVS-EGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFELKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTA 269          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP72_CANAL (Heat shock protein SSA2 OS=Candida albicans GN=SSA2 PE=1 SV=3)

HSP 1 Score: 363.614 bits (932), Expect = 5.749e-100
Identity = 188/234 (80.34%), Postives = 205/234 (87.61%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPS+V FTDTERLIGDAAKNQ AMNP NTVFDAKRLIGR+F D  VQGD+K +PFKV+   A KPMI V YKGE K F+ EEISSM+L KM+E AE +LG+T+K+AVVTVPAYFNDSQRQATKDAG IAGLNVMRIINEPTAAAIAYGLDKK  S  EKNVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNR+VN F+QEFKRK + DIS N RALRRLRTA
Sbjct:   34 RTTPSFVAFTDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDDHEVQGDIKHFPFKVV-DKASKPMIQVEYKGETKTFSPEEISSMILGKMKETAEGFLGTTVKDAVVTVPAYFNDSQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKK--SEAEKNVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRLVNFFIQEFKRKNKKDISTNQRALRRLRTA 264          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_XENLA (Heat shock 70 kDa protein OS=Xenopus laevis PE=2 SV=1)

HSP 1 Score: 363.229 bits (931), Expect = 7.509e-100
Identity = 185/234 (79.06%), Postives = 204/234 (87.18%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+D  VQ D+K WPF+V++    KP + V YKGEEK F  EEISSMVL KM+E AEAYLG  + NAV+TVPAYFNDSQRQATKDAGV+AGLN++RIINEPTAAAIAYGLDK A   GE+NVLIFDLGGGTFDVS+LTI++GIFEVKATAGDTHLGGEDFDNRMVNHFV+EFKRK + DI  N RALRRLRTA
Sbjct:   37 RTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRKFNDPVVQCDLKHWPFQVVSDEG-KPKVKVEYKGEEKSFFPEEISSMVLTKMKETAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVLAGLNILRIINEPTAAAIAYGLDKGAR--GEQNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRMVNHFVEEFKRKHKKDIGQNKRALRRLRTA 267          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_PYRSA (Heat shock 70 kDa protein OS=Pyrenomonas salina GN=HSP70 PE=3 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 9.807e-100
Identity = 184/235 (78.30%), Postives = 205/235 (87.23%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKAT-SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FT+TERLIGD+AKNQVAMNP NTVFDAKRLIGRRF D +VQ D+K +PFKVI    DKP + V YKGE K FA EEISSMVL+KM+EIAE++LG  +KNAV+TVPAYFNDSQRQATKDAG I GLNV+RIINEPTAAAIAYGLDKK + S  E+NVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD+R+VN FV EFKRK + D++ N R+LRRLRTA
Sbjct:   39 RTTPSYVAFTETERLIGDSAKNQVAMNPDNTVFDAKRLIGRRFQDPAVQEDVKPFPFKVICKDGDKPAVEVKYKGETKIFAPEEISSMVLLKMKEIAESFLGKEVKNAVITVPAYFNDSQRQATKDAGAITGLNVLRIINEPTAAAIAYGLDKKTSGSKSERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDSRLVNFFVSEFKRKYKKDVTSNARSLRRLRTA 273          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_CHLRE (Heat shock 70 kDa protein OS=Chlamydomonas reinhardtii GN=HSP70 PE=2 SV=2)

HSP 1 Score: 362.844 bits (930), Expect = 9.807e-100
Identity = 186/236 (78.81%), Postives = 206/236 (87.29%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGST--IKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNP +TVFDAKRLIGR+FSD  VQ D+KLWPF+V AG  D P I V+YK EEK F AEEISSMVLIKM+E A+A LG+   +K AVVTVPAYFNDSQRQATKDAG+IAGL V+RIINEPTAAAI+YGLDKK + +GE+NVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD R+VNHF  EF+RK + D+  +PRALRRLRTA
Sbjct:   37 RTTPSYVAFTDTERLIGDAAKNQVAMNPRHTVFDAKRLIGRKFSDPIVQADIKLWPFQVRAGAHDVPEIVVSYKNEEKVFKAEEISSMVLIKMKETAQASLGADREVKKAVVTVPAYFNDSQRQATKDAGMIAGLEVLRIINEPTAAAISYGLDKKDSGLGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDERLVNHFANEFQRKYKKDLKTSPRALRRLRTA 272          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HS71L_RAT (Heat shock 70 kDa protein 1-like OS=Rattus norvegicus GN=Hspa1l PE=2 SV=2)

HSP 1 Score: 362.844 bits (930), Expect = 9.807e-100
Identity = 186/234 (79.49%), Postives = 208/234 (88.89%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+D  VQ DMKLWPF+VI   A KP + V+YKGE+K F  EEISSMVL KM+E AEA+LG ++ NAV+TVPAYFNDSQRQATKDAGVIAGLNV+RIINEPTAAAIAYGLDK   S GE++VLIFDLGGGTFDVS+LTI++GIFEVKATAGDTHLGGEDFDNR+V+HFV+EFKRK + DIS N RA+RRLRTA
Sbjct:   38 RTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVI-NEAGKPKVLVSYKGEKKAFYPEEISSMVLTKMKETAEAFLGHSVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDK--GSHGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTA 268          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HS71L_MOUSE (Heat shock 70 kDa protein 1-like OS=Mus musculus GN=Hspa1l PE=2 SV=4)

HSP 1 Score: 362.844 bits (930), Expect = 9.807e-100
Identity = 186/234 (79.49%), Postives = 207/234 (88.46%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+D  VQ DMKLWPF+VI   A KP + V+YKGE+K F  EEISSMVL KM+E AEA+LG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV+RIINEPTAAAIAYGLDK   S GE++VLIFDLGGGTFDVS+LTI++GIFEVKATAGDTHLGGEDFDNR+V+HFV+EFKRK + DIS N RA+RRLRTA
Sbjct:   38 RTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVI-NEAGKPKVMVSYKGEKKAFYPEEISSMVLTKMKETAEAFLGHNVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDK--GSHGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTA 268          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP7C_ICTPU (Heat shock cognate 71 kDa protein OS=Ictalurus punctatus GN=hsc70 PE=2 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 1.281e-99
Identity = 183/234 (78.21%), Postives = 204/234 (87.18%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTD+ERLIGDAAKNQVAMNPTNT+FDAKRLIGRRF D+ VQ DMK WPFKVI+    +P + V YKGE K F  EEISSMVL+KM+EIAEAYLG +I NAV+TVPAYFNDSQRQ TKDAG I+GLNV+RIINEPTAAAIAYGLDKK  S  E+NVLIFDLGGGTFDVS+LTIE+GIF++K+TAGDTHLGGEDFDNRMVNHF+ EFKRK + DIS N RA+RRL TA
Sbjct:   36 RTTPSYVAFTDSERLIGDAAKNQVAMNPTNTIFDAKRLIGRRFEDSVVQADMKHWPFKVISD-GGRPRLEVEYKGEAKNFYPEEISSMVLVKMKEIAEAYLGKSINNAVITVPAYFNDSQRQRTKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGS--ERNVLIFDLGGGTFDVSILTIEDGIFDLKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISDNKRAVRRLATA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HS71L_PIG (Heat shock 70 kDa protein 1-like OS=Sus scrofa GN=HSPA1L PE=2 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 1.281e-99
Identity = 185/234 (79.06%), Postives = 206/234 (88.03%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+D  VQ DMKLWPF+VI     KP + V+YKGE+K F  EEISSMVL KM+E AEA+LG T+ NAV+TVPAYFNDSQRQATKDAGVIAGLNV+RIINEPTAAAIAYGLDK     GE++VLIFDLGGGTFDVS+LTI++GIFEVKATAGDTHLGGEDFDNR+V+HFV+EFKRK + DIS N RA+RRLRTA
Sbjct:   38 RTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVI-NEGGKPKVMVSYKGEKKAFYPEEISSMVLTKMKETAEAFLGYTVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDK--AGQGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTA 268          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HS71A_PIG (Heat shock 70 kDa protein 1A OS=Sus scrofa GN=HSPA1A PE=3 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 1.281e-99
Identity = 185/234 (79.06%), Postives = 203/234 (86.75%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPS V FTDTERLIGDAAKNQVA+NP NTVFDAKRLIGR+F D  VQGDMK WPF+VI    DKP + V+YKGE K F  EEISSMVL KM+EIAE YLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV+RIINEPTAAAIAYGLD+  T  GE+NVLIFDLGGGTFDVS+LTI++GIFEVKATAGDTHLGGEDFDNR+VNHFV+EFKRK + D S N RA+RRLRTA
Sbjct:   36 RTTPSSVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQGDMKHWPFRVI-NDGDKPKVQVSYKGETKGFYPEEISSMVLTKMKEIAEGYLGHPVSNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDR--TGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDYSQNKRAVRRLRTA 266          
The following BLAST results are available for this feature:
BLAST of FC875481 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP72_MOUSE5.749e-10077.35Heat shock-related 70 kDa protein 2 OS=Mus musculu... [more]
HSP72_CANAL5.749e-10080.34Heat shock protein SSA2 OS=Candida albicans GN=SSA... [more]
HSP70_XENLA7.509e-10079.06Heat shock 70 kDa protein OS=Xenopus laevis PE=2 S... [more]
HSP70_PYRSA9.807e-10078.30Heat shock 70 kDa protein OS=Pyrenomonas salina GN... [more]
HSP70_CHLRE9.807e-10078.81Heat shock 70 kDa protein OS=Chlamydomonas reinhar... [more]
HS71L_RAT9.807e-10079.49Heat shock 70 kDa protein 1-like OS=Rattus norvegi... [more]
HS71L_MOUSE9.807e-10079.49Heat shock 70 kDa protein 1-like OS=Mus musculus G... [more]
HSP7C_ICTPU1.281e-9978.21Heat shock cognate 71 kDa protein OS=Ictalurus pun... [more]
HS71L_PIG1.281e-9979.06Heat shock 70 kDa protein 1-like OS=Sus scrofa GN=... [more]
HS71A_PIG1.281e-9979.06Heat shock 70 kDa protein 1A OS=Sus scrofa GN=HSPA... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31404D09EF CTVClemen1 Citrus clementina cDNA clone C31404D09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875481 ID=FC875481|Name=FC875481|organism=Citrus clementina|type=EST|length=703bp
AGGACGACGCCGTCTTATGTGGGGTTCACCGACACGGAGCGTTTGATCGG
GGACGCTGCTAAGAACCAGGTCGCCATGAACCCCACGAACACCGTCTTTG
ATGCAAAGAGGTTGATTGGTAGGAGATTCAGCGATGCATCAGTCCAAGGA
GATATGAAGCTATGGCCATTTAAGGTGATTGCTGGACCAGCTGACAAGCC
CATGATTGGTGTTAACTACAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGG
AAATCTCGTCTATGGTGCTCATCAAGATGCGTGAGATTGCCGAGGCTTAC
CTTGGCTCAACTATTAAGAATGCAGTCGTTACTGTCCCTGCTTACTTCAA
TGACTCACAGAGGCAGGCCACCAAGGATGCTGGTGTCATTGCTGGGCTTA
ATGTGATGCGTATCATCAATGAGCCCACTGCTGCTGCCATTGCTTATGGC
CTTGACAAGAAGGCTACTAGTGTGGGTGAGAAGAATGTGTTGATCTTTGA
TTTGGGTGGTGGTACTTTTGATGTGTCGTTGCTCACTATTGAGGAGGGAA
TCTTTGAAGTGAAGGCTACTGCTGGAGACACTCATCTTGGTGGTGAGGAT
TTTGATAACAGAATGGTGAATCATTTTGTTCAGGAGTTTAAGAGGAAGAA
ACAGAANGATATTAGTGGCAACCCTAGAGCTCTTAGGAGATTGAGGACTG
CTT
back to top