FC875481

Overview
NameFC875481
Unique NameFC875481
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length703
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:223..925. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP75_CANAL (Heat shock protein SSB1 OS=Candida albicans GN=SSB1 PE=1 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 9.853e-84
Identity = 161/234 (68.80%), Postives = 185/234 (79.06%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            R TPS+V FT  ERLIGDAAKNQ A+NP NTVFDAKRLIGR F D SVQ D+K WPFKV+     +P+I V Y  E K F+ +EISSMVL KM+EIAEA +G  ++ AVVTVPAYFND+QRQATKDAG IAGLNV+RIINEPTAAAIAYGL     S  E++VLIFDLGGGTFDVSLL I  G+F VKATAGDTHLGG+DFD  ++ HF +EF++K   DIS + RALRRLRTA
Sbjct:   38 RVTPSFVAFTSEERLIGDAAKNQAALNPKNTVFDAKRLIGRAFDDESVQKDIKSWPFKVVESNG-QPLIEVEYLDETKTFSPQEISSMVLTKMKEIAEAKIGKKVEKAVVTVPAYFNDAQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLG-AGKSEKERHVLIFDLGGGTFDVSLLNITGGVFTVKATAGDTHLGGQDFDTNLLEHFKKEFQKKTGNDISSDARALRRLRTA 269          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP75_CANGA (Heat shock protein SSB OS=Candida glabrata GN=SSB1 PE=3 SV=3)

HSP 1 Score: 308.145 bits (788), Expect = 2.867e-83
Identity = 159/234 (67.95%), Postives = 186/234 (79.49%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            R TPS+V FT  ERLIGDAAKNQ A+NP NTVFDAKRLIGRRF + SVQ DMK WPFKV+      P+I V Y GE KQF+ +EISSMVL KM+EIAEA +G  ++ AV+TVPAYFND+QRQATKDAG I+GLNV+RIINEPTAAAIAYGL     S  E++VLIFDLGGGTFDVSLL I  G++ VK+T+G+THLGG+DFD  ++ HF  EFK+K   DIS + RALRRLRTA
Sbjct:   38 RVTPSFVAFTPEERLIGDAAKNQAALNPKNTVFDAKRLIGRRFDEESVQNDMKTWPFKVVDVDG-APVIEVEYLGENKQFSPQEISSMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQATKDAGAISGLNVLRIINEPTAAAIAYGLG-AGKSDKERHVLIFDLGGGTFDVSLLHIAGGVYTVKSTSGNTHLGGQDFDTNLLEHFKGEFKKKTGLDISNDARALRRLRTA 269          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP75_KLUDE (Heat shock protein SSB OS=Kluyveromyces delphensis GN=SSB PE=3 SV=3)

HSP 1 Score: 307.76 bits (787), Expect = 3.744e-83
Identity = 158/234 (67.52%), Postives = 186/234 (79.49%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            R TPS+V FT  ERLIGDAAKNQ A+NP NTVFDAKRLIGRRF + SVQ DMK WPFKV+      P+I V Y GE KQF+ +EISSMVL KM+EIAEA +G  ++ AV+TVPAYFND+QRQATKDAG I+GLNV+RIINEPTAAAIAYGL     S  E++VLIFDLGGGTFDVSLL I  G++ VK+T+G+THLGG+DFD  ++ HF  +FK+K   DIS + RALRRLRTA
Sbjct:   38 RVTPSFVAFTPEERLIGDAAKNQAALNPKNTVFDAKRLIGRRFDEESVQNDMKTWPFKVV-DVEGAPVIEVEYLGETKQFSPQEISSMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQATKDAGAISGLNVLRIINEPTAAAIAYGLG-AGKSDKERHVLIFDLGGGTFDVSLLHIAGGVYTVKSTSGNTHLGGQDFDTNLLEHFKSDFKKKTGLDISNDARALRRLRTA 269          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP75_ZYGRC (Heat shock protein SSB OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / IFO 1130 / NBRC 1623 / NCYC 568) GN=SSB PE=3 SV=3)

HSP 1 Score: 307.375 bits (786), Expect = 4.890e-83
Identity = 159/234 (67.95%), Postives = 186/234 (79.49%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            R TPS+V FT  ERLIGDAAKNQ A+NP NTVFDAKRLIGRRF D SVQ D K WPFK+I    + P++ V Y GE K F+ +EISSMVL KM+EIAEA +G  ++ AV+TVPAYFND+QRQATKDAG I+GLNV+RIINEPTAAAIAYGL     S  E++VLIFDLGGGTFDVSLL I  G++ VK+T+G+THLGG+DFD  M+ HF  EFK+K   DISG+ RALRRLRTA
Sbjct:   38 RVTPSFVAFTPEERLIGDAAKNQAALNPENTVFDAKRLIGRRFDDESVQKDRKTWPFKLIDVEGN-PVVEVQYLGETKTFSPQEISSMVLTKMKEIAEAKIGQKVEKAVITVPAYFNDAQRQATKDAGSISGLNVLRIINEPTAAAIAYGLG-AGKSEKERHVLIFDLGGGTFDVSLLHIAGGVYTVKSTSGNTHLGGQDFDTNMLEHFKNEFKKKTGNDISGDARALRRLRTA 269          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: GRP78_ECHMU (78 kDa glucose-regulated protein OS=Echinococcus multilocularis GN=GRP78 PE=2 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 8.341e-83
Identity = 158/233 (67.81%), Postives = 192/233 (82.40%), Query Frame = 1
Query:    1 RTTPSYVGFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLR 696
            R TPSYV F+ D ERLIGDAAKNQ+  NP NT+FDAKRLIGR + D  VQGD+K +PFKVI    +KP + V    EEK FA EE+S+MVL KM+EIAEAYLG+ + +AVVTVPAYFND+QRQATKDAG IAGL V+RIINEPTAAAIAYGLDKK T   EKN+L+FDLGGGTFDVSLLTI+ G+FEV AT+GDTHLGGEDFD R++++FV+ +K+K+  DI+ + RA+++LR
Sbjct:   60 RITPSYVAFSGDGERLIGDAAKNQLTSNPKNTLFDAKRLIGRDYDDKDVQGDIKRYPFKVI-NKNNKPYMKVQVGSEEKGFAPEEVSAMVLSKMKEIAEAYLGTEVTHAVVTVPAYFNDAQRQATKDAGAIAGLTVLRIINEPTAAAIAYGLDKKDT---EKNILVFDLGGGTFDVSLLTIDNGVFEVVATSGDTHLGGEDFDQRLIDYFVKLYKKKEGKDITKDDRAVQKLR 288          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP7C_DROME (Heat shock 70 kDa protein cognate 3 OS=Drosophila melanogaster GN=Hsc70-3 PE=2 SV=2)

HSP 1 Score: 305.449 bits (781), Expect = 1.858e-82
Identity = 162/233 (69.53%), Postives = 189/233 (81.12%), Query Frame = 1
Query:    1 RTTPSYVGFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLR 696
            R TPSYV FT D ERLIGDAAKNQ+  NP NTVFDAKRLIGR +SD +VQ D+K +PFKV+   + KP I V+     K FA EEIS+MVL KM+E AEAYLG  + +AVVTVPAYFND+QRQATKDAGVIAGL VMRIINEPTAAAIAYGLDKK    GEKNVL+FDLGGGTFDVSLLTI+ G+FEV AT GDTHLGGEDFD R+++HF++ +K+KK  DI  + RA+++LR
Sbjct:   61 RITPSYVAFTADGERLIGDAAKNQLTTNPENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKNS-KPHISVDTSQGAKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKKE---GEKNVLVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMDHFIKLYKKKKGKDIRKDNRAVQKLR 289          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP7C_CAEEL (Heat shock 70 kDa protein C OS=Caenorhabditis elegans GN=hsp-3 PE=2 SV=2)

HSP 1 Score: 305.449 bits (781), Expect = 1.858e-82
Identity = 152/234 (64.96%), Postives = 191/234 (81.62%), Query Frame = 1
Query:    1 RTTPSYVGFTDTE--RLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLR 696
            R TPSYV F+  +  RLIGDAAKNQ+ +NP NT+FDAKRLIGR ++D +VQ D+K WPFKVI   ++KP + V    + KQF  EE+S+MVL+KM+EIAE+YLG  +KNAVVTVPAYFND+QRQATKDAG IAGLNV+RIINEPTAAAIAYGLDKK    GE+N+L+FDLGGGTFDVS+LTI+ G+FEV AT GDTHLGGEDFD R++ +F++ +K+K   D+  + RA+++LR
Sbjct:   65 RITPSYVAFSGDQGDRLIGDAAKNQLTINPENTIFDAKRLIGRDYNDKTVQADIKHWPFKVI-DKSNKPSVEVKVGSDNKQFTPEEVSAMVLVKMKEIAESYLGKEVKNAVVTVPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLDKKD---GERNILVFDLGGGTFDVSMLTIDNGVFEVLATNGDTHLGGEDFDQRVMEYFIKLYKKKSGKDLRKDKRAVQKLR 294          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: BIP2_ARATH (Luminal-binding protein 2 OS=Arabidopsis thaliana GN=At5g42020 PE=1 SV=2)

HSP 1 Score: 305.064 bits (780), Expect = 2.427e-82
Identity = 158/233 (67.81%), Postives = 189/233 (81.12%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYK-GEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLR 696
            R TPS+VGFTD+ERLIG+AAKNQ A+NP  TVFD KRLIGR+F D  VQ D KL P++++     KP I V  K GE K F+ EEIS+M+L KM+E AEAYLG  IK+AVVTVPAYFND+QRQATKDAGVIAGLNV RIINEPTAAAIAYGLDKK    GEKN+L+FDLGGGTFDVS+LTI+ G+FEV +T GDTHLGGEDFD+R++ +F++  K+K Q DIS + +AL +LR
Sbjct:   67 RITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIV-NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKG---GEKNILVFDLGGGTFDVSVLTIDNGVFEVLSTNGDTHLGGEDFDHRIMEYFIKLIKKKHQKDISKDNKALGKLR 295          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: BIP1_ARATH (Luminal-binding protein 1 OS=Arabidopsis thaliana GN=At5g28540 PE=1 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 2.427e-82
Identity = 158/233 (67.81%), Postives = 189/233 (81.12%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYK-GEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLR 696
            R TPS+VGFTD+ERLIG+AAKNQ A+NP  TVFD KRLIGR+F D  VQ D KL P++++     KP I V  K GE K F+ EEIS+M+L KM+E AEAYLG  IK+AVVTVPAYFND+QRQATKDAGVIAGLNV RIINEPTAAAIAYGLDKK    GEKN+L+FDLGGGTFDVS+LTI+ G+FEV +T GDTHLGGEDFD+R++ +F++  K+K Q DIS + +AL +LR
Sbjct:   67 RITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIV-NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKG---GEKNILVFDLGGGTFDVSVLTIDNGVFEVLSTNGDTHLGGEDFDHRVMEYFIKLIKKKHQKDISKDNKALGKLR 295          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: GRP78_ECHGR (78 kDa glucose-regulated protein OS=Echinococcus granulosus GN=GRP78 PE=2 SV=1)

HSP 1 Score: 304.679 bits (779), Expect = 3.170e-82
Identity = 157/233 (67.38%), Postives = 192/233 (82.40%), Query Frame = 1
Query:    1 RTTPSYVGFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLR 696
            R TPSYV F+ D ERLIGDAAKNQ+  NP NT+FDAKRLIGR + D  VQGD+K +PFKVI    +KP + V    EEK FA EE+S+MVL KM+EIAEAYLG+ + +AVVTVPAYFND+QRQATKDAG IAGL V+RIINEPTAAAIAYGL+KK T   EKN+L+FDLGGGTFDVSLLTI+ G+FEV AT+GDTHLGGEDFD R++++FV+ +K+K+  DI+ + RA+++LR
Sbjct:   60 RITPSYVAFSGDGERLIGDAAKNQLTSNPKNTLFDAKRLIGRDYHDKDVQGDIKRYPFKVI-NKNNKPYMKVQVGSEEKGFAPEEVSAMVLSKMKEIAEAYLGTEVTHAVVTVPAYFNDAQRQATKDAGAIAGLTVLRIINEPTAAAIAYGLEKKDT---EKNILVFDLGGGTFDVSLLTIDNGVFEVVATSGDTHLGGEDFDQRLIDYFVKLYKKKEGKDITKDDRAVQKLR 288          
The following BLAST results are available for this feature:
BLAST of FC875481 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP75_CANAL9.853e-8468.80Heat shock protein SSB1 OS=Candida albicans GN=SSB... [more]
HSP75_CANGA2.867e-8367.95Heat shock protein SSB OS=Candida glabrata GN=SSB1... [more]
HSP75_KLUDE3.744e-8367.52Heat shock protein SSB OS=Kluyveromyces delphensis... [more]
HSP75_ZYGRC4.890e-8367.95Heat shock protein SSB OS=Zygosaccharomyces rouxii... [more]
GRP78_ECHMU8.341e-8367.8178 kDa glucose-regulated protein OS=Echinococcus m... [more]
HSP7C_DROME1.858e-8269.53Heat shock 70 kDa protein cognate 3 OS=Drosophila ... [more]
HSP7C_CAEEL1.858e-8264.96Heat shock 70 kDa protein C OS=Caenorhabditis eleg... [more]
BIP2_ARATH2.427e-8267.81Luminal-binding protein 2 OS=Arabidopsis thaliana ... [more]
BIP1_ARATH2.427e-8267.81Luminal-binding protein 1 OS=Arabidopsis thaliana ... [more]
GRP78_ECHGR3.170e-8267.3878 kDa glucose-regulated protein OS=Echinococcus g... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31404D09EF CTVClemen1 Citrus clementina cDNA clone C31404D09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875481 ID=FC875481|Name=FC875481|organism=Citrus clementina|type=EST|length=703bp
AGGACGACGCCGTCTTATGTGGGGTTCACCGACACGGAGCGTTTGATCGG
GGACGCTGCTAAGAACCAGGTCGCCATGAACCCCACGAACACCGTCTTTG
ATGCAAAGAGGTTGATTGGTAGGAGATTCAGCGATGCATCAGTCCAAGGA
GATATGAAGCTATGGCCATTTAAGGTGATTGCTGGACCAGCTGACAAGCC
CATGATTGGTGTTAACTACAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGG
AAATCTCGTCTATGGTGCTCATCAAGATGCGTGAGATTGCCGAGGCTTAC
CTTGGCTCAACTATTAAGAATGCAGTCGTTACTGTCCCTGCTTACTTCAA
TGACTCACAGAGGCAGGCCACCAAGGATGCTGGTGTCATTGCTGGGCTTA
ATGTGATGCGTATCATCAATGAGCCCACTGCTGCTGCCATTGCTTATGGC
CTTGACAAGAAGGCTACTAGTGTGGGTGAGAAGAATGTGTTGATCTTTGA
TTTGGGTGGTGGTACTTTTGATGTGTCGTTGCTCACTATTGAGGAGGGAA
TCTTTGAAGTGAAGGCTACTGCTGGAGACACTCATCTTGGTGGTGAGGAT
TTTGATAACAGAATGGTGAATCATTTTGTTCAGGAGTTTAAGAGGAAGAA
ACAGAANGATATTAGTGGCAACCCTAGAGCTCTTAGGAGATTGAGGACTG
CTT
back to top