FC875481

Overview
NameFC875481
Unique NameFC875481
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length703
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:223..925. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: DNAK_PSEA8 (Chaperone protein dnaK OS=Pseudomonas aeruginosa (strain LESB58) GN=dnaK PE=2 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 3.410e-60
Identity = 127/239 (53.14%), Postives = 168/239 (70.29%), Query Frame = 1
Query:    1 RTTPSYVGFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIE----EGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPS + +T D E L+G  AK Q   NP NT++  KRLIGRRF +  VQ D+++ P+ ++   AD     V  KG++   A  +IS+ VL KM++ AE YLG  +  AV+TVPAYFNDSQRQATKDAG IAGL+V RIINEPTAAA+AYGLDK   + G+  V+++DLGGGTFDVS++ I     E  FEV AT GDT LGGEDFD R++++ V EFK++   ++ G+P A++RL+ A
Sbjct:   34 RTTPSIIAYTNDGETLVGQPAKRQAVTNPQNTLYAVKRLIGRRFEENVVQKDIQMVPYSIVK--ADNGDAWVEVKGQK--MAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDSQRQATKDAGRIAGLDVKRIINEPTAAALAYGLDK---AKGDHTVIVYDLGGGTFDVSVIEIAEVDGEHQFEVLATNGDTFLGGEDFDIRLIDYLVDEFKKESGINLKGDPLAMQRLKEA 265          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: DNAK_PSEA7 (Chaperone protein dnaK OS=Pseudomonas aeruginosa (strain PA7) GN=dnaK PE=2 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 3.410e-60
Identity = 127/239 (53.14%), Postives = 168/239 (70.29%), Query Frame = 1
Query:    1 RTTPSYVGFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIE----EGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPS + +T D E L+G  AK Q   NP NT++  KRLIGRRF +  VQ D+++ P+ ++   AD     V  KG++   A  +IS+ VL KM++ AE YLG  +  AV+TVPAYFNDSQRQATKDAG IAGL+V RIINEPTAAA+AYGLDK   + G+  V+++DLGGGTFDVS++ I     E  FEV AT GDT LGGEDFD R++++ V EFK++   ++ G+P A++RL+ A
Sbjct:   34 RTTPSIIAYTNDGETLVGQPAKRQAVTNPQNTLYAVKRLIGRRFEENVVQKDIQMVPYSIVK--ADNGDAWVEVKGQK--MAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDSQRQATKDAGRIAGLDVKRIINEPTAAALAYGLDK---AKGDHTVIVYDLGGGTFDVSVIEIAEVDGEHQFEVLATNGDTFLGGEDFDIRLIDYLVDEFKKESGINLKGDPLAMQRLKEA 265          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: DNAK_HAEIE (Chaperone protein dnaK OS=Haemophilus influenzae (strain PittEE) GN=dnaK PE=2 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 3.410e-60
Identity = 122/238 (51.26%), Postives = 166/238 (69.75%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIE----EGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPS + +TD E L+G  AK Q   NP NT+F  KRLIGRRF    VQ D+K+ PF++    AD     VN KG++   A  +IS+ VL KM++ AE +LG  +  AV+TVPAYFND+QRQAT DAG IAGL+V RIINEPTAAA+A+GL    +S   + + ++DLGGGTFD+S++ I+    E  FEV AT G+THLGGEDFDNR++++ + EFK+++  D+  +  AL+R++ A
Sbjct:   34 RTTPSIIAYTDNETLVGQPAKRQAITNPKNTLFAIKRLIGRRFESEEVQRDIKIMPFEITR--ADNGDAWVNVKGDK--LAPPQISAEVLKKMKKTAEDFLGEAVTEAVITVPAYFNDAQRQATIDAGKIAGLDVKRIINEPTAAALAFGL---GSSKENQVIAVYDLGGGTFDISIIEIDNFDGEQTFEVLATGGNTHLGGEDFDNRVIDYIIDEFKKEQNIDLRNDAMALQRVKEA 264          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: DNAK_BDEBA (Chaperone protein dnaK OS=Bdellovibrio bacteriovorus GN=dnaK PE=2 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 3.410e-60
Identity = 121/235 (51.49%), Postives = 165/235 (70.21%), Query Frame = 1
Query:    1 RTTPSYVGFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPS V +T D +RL+G  AK Q   NP NT++ AKR IGRRF +  +Q ++KL P+ V+A   D       +K + K  + EEI + VL K++++AE YLG  +  AVVTVPAYFND+QRQATKDAG IAGL V RIINEPTAAA+AYG+DKK     ++ ++I+D GGGTFDVS+L + +G+ EV+AT GDTHLGG++FD  ++   + EFK+ +  D+  +  AL+RL+ A
Sbjct:   34 RTTPSVVAYTKDGDRLVGQIAKRQAVTNPENTIYSAKRFIGRRFEE--IQEEIKLVPYTVVAKGND-----CAFKVQGKTASPEEIGAAVLAKLKKVAEDYLGEPVTEAVVTVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGMDKKK----DEKIVIYDFGGGTFDVSILEVGDGVVEVRATNGDTHLGGDNFDTVILEWLITEFKKDQAIDLKNDKMALQRLKEA 257          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: DNAK_RHILE (Chaperone protein dnaK OS=Rhizobium leguminosarum GN=dnaK PE=2 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 4.454e-60
Identity = 121/235 (51.49%), Postives = 159/235 (67.66%), Query Frame = 1
Query:    1 RTTPSYVGFTDT-ERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPS V F+D  ERL+G  AK Q   NPTNT+F  KRLIGRR+ D +V+ D  L PF ++ G      +  N KG    ++  +IS+M+L KM+E AE+YLG  ++ AV+TVPAYFND++    +      GL V+RIINEPTAAA+AYGLDKK      K + ++DLGGGTFD+S+L I +G+FEVK+T GDT LGGEDFD R+V + V EFKR    D+  +  AL+RL+ A
Sbjct:   34 RTTPSMVAFSDDGERLVGQPAKRQAVTNPTNTLFAVKRLIGRRYEDPTVEKDKHLVPFTIVKGDNGDAWVEANGKG----YSPAQISAMILQKMKETAESYLGEKVEKAVITVPAYFNDARPGQPRMPAASLGLEVLRIINEPTAAALAYGLDKKEG----KTIAVYDLGGGTFDISILEIGDGVFEVKSTNGDTFLGGEDFDMRLVEYLVAEFKRDNGIDLKNDKLALQRLKEA 260          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: DNAK_LEGPN (Chaperone protein dnaK OS=Legionella pneumophila GN=dnaK PE=2 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 4.454e-60
Identity = 130/239 (54.39%), Postives = 163/239 (68.20%), Query Frame = 1
Query:    1 RTTPSYVGFTD-TERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIE----EGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPS V FTD  E L+G +AK Q   NP  T+F  KRLIGRRF D  VQ D+K+ P+K++   AD     V  K ++K  A  +IS+ VL KM++ AE YLG  +K AV+TVPAYFNDSQRQATKDAG IAGL V RIINEPTAAA+AYG+DKK    G+  + ++DLGGGTFD+S++ I     E  FEV AT GDT LGGEDFD  ++ +   EFK+    D+  +P AL+RL+ A
Sbjct:   34 RTTPSIVAFTDDNEILVGQSAKRQSVTNPEKTLFAIKRLIGRRFDDPIVQKDIKMVPYKIMK--ADNGDAWVRVKDQDK--APPQISAEVLRKMKKTAEDYLGEEVKEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAYGMDKKR---GDSVIAVYDLGGGTFDISIIEIAEVDGEHQFEVLATNGDTFLGGEDFDLALIEYLASEFKKDTGIDLHNDPLALQRLKEA 265          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: DNAK_LEGPL (Chaperone protein dnaK OS=Legionella pneumophila (strain Lens) GN=dnaK PE=2 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 4.454e-60
Identity = 130/239 (54.39%), Postives = 163/239 (68.20%), Query Frame = 1
Query:    1 RTTPSYVGFTD-TERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIE----EGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPS V FTD  E L+G +AK Q   NP  T+F  KRLIGRRF D  VQ D+K+ P+K++   AD     V  K ++K  A  +IS+ VL KM++ AE YLG  +K AV+TVPAYFNDSQRQATKDAG IAGL V RIINEPTAAA+AYG+DKK    G+  + ++DLGGGTFD+S++ I     E  FEV AT GDT LGGEDFD  ++ +   EFK+    D+  +P AL+RL+ A
Sbjct:   34 RTTPSIVAFTDDNEILVGQSAKRQSVTNPEKTLFAIKRLIGRRFDDPIVQKDIKMVPYKIMK--ADNGDAWVRVKDQDK--APPQISAEVLRKMKKTAEDYLGEEVKEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAYGMDKKR---GDSVIAVYDLGGGTFDISIIEIAEVDGEHQFEVLATNGDTFLGGEDFDLALIEYLASEFKKDTGIDLHNDPLALQRLKEA 265          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: DNAK_LEGPH (Chaperone protein dnaK OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=dnaK PE=2 SV=2)

HSP 1 Score: 231.106 bits (588), Expect = 4.454e-60
Identity = 130/239 (54.39%), Postives = 163/239 (68.20%), Query Frame = 1
Query:    1 RTTPSYVGFTD-TERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIE----EGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPS V FTD  E L+G +AK Q   NP  T+F  KRLIGRRF D  VQ D+K+ P+K++   AD     V  K ++K  A  +IS+ VL KM++ AE YLG  +K AV+TVPAYFNDSQRQATKDAG IAGL V RIINEPTAAA+AYG+DKK    G+  + ++DLGGGTFD+S++ I     E  FEV AT GDT LGGEDFD  ++ +   EFK+    D+  +P AL+RL+ A
Sbjct:   34 RTTPSIVAFTDDNEILVGQSAKRQSVTNPEKTLFAIKRLIGRRFDDPIVQKDIKMVPYKIMK--ADNGDAWVRVKDQDK--APPQISAEVLRKMKKTAEDYLGEEVKEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAYGMDKKR---GDSVIAVYDLGGGTFDISIIEIAEVDGEHQFEVLATNGDTFLGGEDFDLALIEYLASEFKKDTGIDLHNDPLALQRLKEA 265          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: DNAK_LEGPC (Chaperone protein dnaK OS=Legionella pneumophila (strain Corby) GN=dnaK PE=2 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 4.454e-60
Identity = 130/239 (54.39%), Postives = 163/239 (68.20%), Query Frame = 1
Query:    1 RTTPSYVGFTD-TERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIE----EGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPS V FTD  E L+G +AK Q   NP  T+F  KRLIGRRF D  VQ D+K+ P+K++   AD     V  K ++K  A  +IS+ VL KM++ AE YLG  +K AV+TVPAYFNDSQRQATKDAG IAGL V RIINEPTAAA+AYG+DKK    G+  + ++DLGGGTFD+S++ I     E  FEV AT GDT LGGEDFD  ++ +   EFK+    D+  +P AL+RL+ A
Sbjct:   34 RTTPSIVAFTDDNEILVGQSAKRQSVTNPEKTLFAIKRLIGRRFDDPIVQKDIKMVPYKIMK--ADNGDAWVRVKDQDK--APPQISAEVLRKMKKTAEDYLGEEVKEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAYGMDKKR---GDSVIAVYDLGGGTFDISIIEIAEVDGEHQFEVLATNGDTFLGGEDFDLALIEYLASEFKKDTGIDLHNDPLALQRLKEA 265          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: DNAK_LEGPA (Chaperone protein dnaK OS=Legionella pneumophila (strain Paris) GN=dnaK PE=2 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 4.454e-60
Identity = 130/239 (54.39%), Postives = 163/239 (68.20%), Query Frame = 1
Query:    1 RTTPSYVGFTD-TERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIE----EGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPS V FTD  E L+G +AK Q   NP  T+F  KRLIGRRF D  VQ D+K+ P+K++   AD     V  K ++K  A  +IS+ VL KM++ AE YLG  +K AV+TVPAYFNDSQRQATKDAG IAGL V RIINEPTAAA+AYG+DKK    G+  + ++DLGGGTFD+S++ I     E  FEV AT GDT LGGEDFD  ++ +   EFK+    D+  +P AL+RL+ A
Sbjct:   34 RTTPSIVAFTDDNEILVGQSAKRQSVTNPEKTLFAIKRLIGRRFDDPIVQKDIKMVPYKIMK--ADNGDAWVRVKDQDK--APPQISAEVLRKMKKTAEDYLGEEVKEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAYGMDKKR---GDSVIAVYDLGGGTFDISIIEIAEVDGEHQFEVLATNGDTFLGGEDFDLALIEYLASEFKKDTGIDLHNDPLALQRLKEA 265          
The following BLAST results are available for this feature:
BLAST of FC875481 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
DNAK_PSEA83.410e-6053.14Chaperone protein dnaK OS=Pseudomonas aeruginosa (... [more]
DNAK_PSEA73.410e-6053.14Chaperone protein dnaK OS=Pseudomonas aeruginosa (... [more]
DNAK_HAEIE3.410e-6051.26Chaperone protein dnaK OS=Haemophilus influenzae (... [more]
DNAK_BDEBA3.410e-6051.49Chaperone protein dnaK OS=Bdellovibrio bacteriovor... [more]
DNAK_RHILE4.454e-6051.49Chaperone protein dnaK OS=Rhizobium leguminosarum ... [more]
DNAK_LEGPN4.454e-6054.39Chaperone protein dnaK OS=Legionella pneumophila G... [more]
DNAK_LEGPL4.454e-6054.39Chaperone protein dnaK OS=Legionella pneumophila (... [more]
DNAK_LEGPH4.454e-6054.39Chaperone protein dnaK OS=Legionella pneumophila s... [more]
DNAK_LEGPC4.454e-6054.39Chaperone protein dnaK OS=Legionella pneumophila (... [more]
DNAK_LEGPA4.454e-6054.39Chaperone protein dnaK OS=Legionella pneumophila (... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31404D09EF CTVClemen1 Citrus clementina cDNA clone C31404D09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875481 ID=FC875481|Name=FC875481|organism=Citrus clementina|type=EST|length=703bp
AGGACGACGCCGTCTTATGTGGGGTTCACCGACACGGAGCGTTTGATCGG
GGACGCTGCTAAGAACCAGGTCGCCATGAACCCCACGAACACCGTCTTTG
ATGCAAAGAGGTTGATTGGTAGGAGATTCAGCGATGCATCAGTCCAAGGA
GATATGAAGCTATGGCCATTTAAGGTGATTGCTGGACCAGCTGACAAGCC
CATGATTGGTGTTAACTACAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGG
AAATCTCGTCTATGGTGCTCATCAAGATGCGTGAGATTGCCGAGGCTTAC
CTTGGCTCAACTATTAAGAATGCAGTCGTTACTGTCCCTGCTTACTTCAA
TGACTCACAGAGGCAGGCCACCAAGGATGCTGGTGTCATTGCTGGGCTTA
ATGTGATGCGTATCATCAATGAGCCCACTGCTGCTGCCATTGCTTATGGC
CTTGACAAGAAGGCTACTAGTGTGGGTGAGAAGAATGTGTTGATCTTTGA
TTTGGGTGGTGGTACTTTTGATGTGTCGTTGCTCACTATTGAGGAGGGAA
TCTTTGAAGTGAAGGCTACTGCTGGAGACACTCATCTTGGTGGTGAGGAT
TTTGATAACAGAATGGTGAATCATTTTGTTCAGGAGTTTAAGAGGAAGAA
ACAGAANGATATTAGTGGCAACCCTAGAGCTCTTAGGAGATTGAGGACTG
CTT
back to top