FC875481

Overview
NameFC875481
Unique NameFC875481
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length703
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:223..925. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP7C_ORYLA (Heat shock cognate 71 kDa protein OS=Oryzias latipes GN=hsc70 PE=2 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 1.673e-99
Identity = 185/234 (79.06%), Postives = 201/234 (85.90%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRF D  VQ DM  WPF VI     +P + V YKGE K F  EE+SSMVL KM+EIAEAYLG T+ NAV+TVPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAAIAYGLDKK  S  E+NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHF+ EFKRK + DIS N RA+RRLR+A
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDHVVQSDMNDWPFNVI-NDNTRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVNNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGS--ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRSA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_BRUMA (Heat shock 70 kDa protein OS=Brugia malayi GN=HSP70 PE=3 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 1.673e-99
Identity = 183/234 (78.21%), Postives = 201/234 (85.90%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNP NTVFDA RLIGR+F D SVQ DMK WPFKV+     KP + V YKGE K F  EEISSMVL+KM+E AEA+LG  +K+AV+TVPAYFNDSQRQATKD+G IAGLNV+RIINEPTAAAIAYGLDKK    GE+NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHL GEDFDNRMVNHFV EFKR  + D++ NPRALRRLRTA
Sbjct:   35 RTTPSYVAFTDTERLIGDAAKNQVAMNPHNTVFDANRLIGRKFDDGSVQSDMKHWPFKVVNAGGGKPKVQVEYKGETKTFTPEEISSMVLVKMKETAEAFLGHAVKDAVITVPAYFNDSQRQATKDSGAIAGLNVLRIINEPTAAAIAYGLDKKGH--GERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHL-GEDFDNRMVNHFVAEFKRNDKKDLASNPRALRRLRTA 265          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HS71L_BOVIN (Heat shock 70 kDa protein 1-like OS=Bos taurus GN=HSPA1L PE=3 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 1.673e-99
Identity = 185/234 (79.06%), Postives = 206/234 (88.03%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+D  VQ DMKLWPF+VI     KP + V+YKGE+K F  EEISSMVL KM+E AEA+LG T+ NAV+TVPAYFNDSQRQATKDAGVIAGLNV+RIINEPTAAAIAYGLDK     GE++VLIFDLGGGTFDVS+LTI++GIFEVKATAGDTHLGGEDFDNR+V+HFV+EFKRK + DIS N RA+RRLRTA
Sbjct:   38 RTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVI-NEGGKPKVMVSYKGEKKAFYPEEISSMVLTKMKETAEAFLGYTVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDK--AGQGERHVLIFDLGGGTFDVSVLTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTA 268          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP71_SCHPO (Probable heat shock protein ssa1 OS=Schizosaccharomyces pombe GN=ssa1 PE=1 SV=2)

HSP 1 Score: 361.688 bits (927), Expect = 2.185e-99
Identity = 186/234 (79.49%), Postives = 204/234 (87.18%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNP NT+FDAKRLIGRRF+D  VQ DMK WPFKVI     KP+I V +KGE K F  EEISSMVL+KMRE AEA+LG  + +AVVTVPAYFNDSQRQATKDAG+IAGLNV+RIINEPTAAAIAYGLD+  ++  E NVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD+R+VNHF QEFKRK + DI+GN RA+RRLRTA
Sbjct:   34 RTTPSYVAFTDTERLIGDAAKNQVAMNPHNTIFDAKRLIGRRFNDPEVQSDMKHWPFKVIEKDG-KPLIQVEFKGETKTFTPEEISSMVLLKMRESAEAFLGGKVTDAVVTVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAIAYGLDR--SNQHETNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDSRLVNHFAQEFKRKNKKDITGNARAVRRLRTA 264          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP72_PICAN (Heat shock protein 70 2 OS=Pichia angusta GN=HSA2 PE=3 SV=2)

HSP 1 Score: 361.303 bits (926), Expect = 2.853e-99
Identity = 184/234 (78.63%), Postives = 205/234 (87.61%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPS+V FTDTERL GDAAKNQ AMNP NTVFDAKRLIGR+F D  VQGD+K +PFKV+   + KP I V +KGE K F  EEISSMVL KM+E AE++LG+T+K+AV+TVPAYFNDSQRQATKDAG+IAGLNVMRIINEPTAAAIAYGLDKK  S GE+NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNR+VNHF+ EFKRK + DI GN RALRRLRTA
Sbjct:   34 RTTPSFVAFTDTERLSGDAAKNQAAMNPANTVFDAKRLIGRKFDDPEVQGDIKHFPFKVV-DKSGKPQIQVEFKGETKVFTPEEISSMVLTKMKETAESFLGTTVKDAVITVPAYFNDSQRQATKDAGLIAGLNVMRIINEPTAAAIAYGLDKK--SQGEQNVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRLVNHFINEFKRKNKKDICGNQRALRRLRTA 264          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP71_CANAL (Heat shock protein SSA1 OS=Candida albicans GN=SSA1 PE=1 SV=2)

HSP 1 Score: 360.918 bits (925), Expect = 3.727e-99
Identity = 189/234 (80.77%), Postives = 202/234 (86.32%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPS+V FTDTERLIGDAAKNQ AMNP NTVFDAKRLIGR+F D  V  D K +PFKVI   A KP+I V YKGE K F+ EEISSMVL KM+EIAE YLGST+K+AVVTVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAAIAYGLDKK  S GE NVLIFDLGGGTFDVSLL I+EGIFEVKATAGDTHLGGEDFDNR+VN F+QEFKRK + DIS N RALRRLRTA
Sbjct:   34 RTTPSFVAFTDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDDPEVINDAKHFPFKVI-DKAGKPVIQVEYKGETKTFSPEEISSMVLTKMKEIAEGYLGSTVKDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKG-SRGEHNVLIFDLGGGTFDVSLLAIDEGIFEVKATAGDTHLGGEDFDNRLVNFFIQEFKRKNKKDISTNQRALRRLRTA 265          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_CLAHE (Heat shock 70 kDa protein OS=Cladosporium herbarum GN=HSP70 PE=1 SV=1)

HSP 1 Score: 360.533 bits (924), Expect = 4.867e-99
Identity = 185/234 (79.06%), Postives = 202/234 (86.32%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPS+V FTDTERLIGD+AKNQVA+NP NTVFDAKRLIGR+F DA VQ DMK +PFKVI   A KP+  V +KGE K F  EEISSM+L KMRE AE+YLG T+ NAV+TVPAYFNDSQRQATKDAG+IAGLNV+RIINEPTAAAIAYGLDKK    GEKNVLIFDLGGGTFDVS LTIEEGIFEVK+TAGDTHLGGEDFDNR+VNHF  EFKRK + D+S N RALRRLRTA
Sbjct:   34 RTTPSFVAFTDTERLIGDSAKNQVAINPHNTVFDAKRLIGRKFQDAEVQADMKHFPFKVIE-KAGKPVTQVEFKGETKDFTPEEISSMILTKMRETAESYLGGTVNNAVITVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAIAYGLDKK--QEGEKNVLIFDLGGGTFDVSFLTIEEGIFEVKSTAGDTHLGGEDFDNRLVNHFSNEFKRKHKKDLSDNARALRRLRTA 264          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_SCHMA (Heat shock 70 kDa protein homolog OS=Schistosoma mansoni PE=2 SV=2)

HSP 1 Score: 359.377 bits (921), Expect = 1.084e-98
Identity = 184/234 (78.63%), Postives = 203/234 (86.75%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTD+ERLIGD AKNQVAMNPTNTVFDAKRLIGRRF D SVQ DMK WPF+V      K  I V YKGE+K F+AEEISSMVL KM+E+AE+YLG T+ +AV+TVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAAIAYGLDKK    GE+NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMV+HFV+EF++K   DI  N RALRRLRTA
Sbjct:   34 RTTPSYVAFTDSERLIGDGAKNQVAMNPTNTVFDAKRLIGRRFDDPSVQSDMKHWPFEVTQ-VGGKLKICVEYKGEKKMFSAEEISSMVLTKMKEVAESYLGRTVSDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKVG--GERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVDHFVKEFQKKYNKDIRSNKRALRRLRTA 264          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HS71L_MACFA (Heat shock 70 kDa protein 1-like OS=Macaca fascicularis GN=HSPA1L PE=2 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 1.084e-98
Identity = 184/234 (78.63%), Postives = 204/234 (87.18%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+D  VQ DMKLWPF+VI     KP + V+YKGE K F  EEISSMVL KM+E AEA+LG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV+RIINEPTAAAIAYGLDK     GE++VLIFDLGGGTFDVS+LTI++GIFEVKATAGDTHLGGEDFDNR+V+HFV+EFKRK + DIS N RA+RRLRTA
Sbjct:   38 RTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVI-NEGGKPKVLVSYKGENKAFYPEEISSMVLTKMKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGR--GERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTA 268          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP74_ANOAL (Heat shock protein 70 B2 OS=Anopheles albimanus GN=HSP70B2 PE=3 SV=1)

HSP 1 Score: 358.607 bits (919), Expect = 1.850e-98
Identity = 183/235 (77.87%), Postives = 202/235 (85.96%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEG-IFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV F+DTERLIGDAAKNQVAMNPTNTVFDAKRLIGR+F D  +Q DMK WPF V+     KP I V +KGE K FA EEISSMVL KM+E AEAYLG ++KNAV+TVPAYFNDSQRQATKDAG IAGLNVMRIINEPTAAA+AYGLDK     GE+NVLIFDLGGGTFDVS+LTI+EG +FEV++TAGDTHLGGEDFDNRMV HFV+EFKRK + D+S N RALRRLRTA
Sbjct:   34 RTTPSYVAFSDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRKFDDPKIQADMKHWPFTVV-NDGGKPKIRVEFKGERKTFAPEEISSMVLTKMKETAEAYLGQSVKNAVITVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLK--GERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRMVGHFVEEFKRKHKKDLSKNARALRRLRTA 265          
The following BLAST results are available for this feature:
BLAST of FC875481 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP7C_ORYLA1.673e-9979.06Heat shock cognate 71 kDa protein OS=Oryzias latip... [more]
HSP70_BRUMA1.673e-9978.21Heat shock 70 kDa protein OS=Brugia malayi GN=HSP7... [more]
HS71L_BOVIN1.673e-9979.06Heat shock 70 kDa protein 1-like OS=Bos taurus GN=... [more]
HSP71_SCHPO2.185e-9979.49Probable heat shock protein ssa1 OS=Schizosaccharo... [more]
HSP72_PICAN2.853e-9978.63Heat shock protein 70 2 OS=Pichia angusta GN=HSA2 ... [more]
HSP71_CANAL3.727e-9980.77Heat shock protein SSA1 OS=Candida albicans GN=SSA... [more]
HSP70_CLAHE4.867e-9979.06Heat shock 70 kDa protein OS=Cladosporium herbarum... [more]
HSP70_SCHMA1.084e-9878.63Heat shock 70 kDa protein homolog OS=Schistosoma m... [more]
HS71L_MACFA1.084e-9878.63Heat shock 70 kDa protein 1-like OS=Macaca fascicu... [more]
HSP74_ANOAL1.850e-9877.87Heat shock protein 70 B2 OS=Anopheles albimanus GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31404D09EF CTVClemen1 Citrus clementina cDNA clone C31404D09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875481 ID=FC875481|Name=FC875481|organism=Citrus clementina|type=EST|length=703bp
AGGACGACGCCGTCTTATGTGGGGTTCACCGACACGGAGCGTTTGATCGG
GGACGCTGCTAAGAACCAGGTCGCCATGAACCCCACGAACACCGTCTTTG
ATGCAAAGAGGTTGATTGGTAGGAGATTCAGCGATGCATCAGTCCAAGGA
GATATGAAGCTATGGCCATTTAAGGTGATTGCTGGACCAGCTGACAAGCC
CATGATTGGTGTTAACTACAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGG
AAATCTCGTCTATGGTGCTCATCAAGATGCGTGAGATTGCCGAGGCTTAC
CTTGGCTCAACTATTAAGAATGCAGTCGTTACTGTCCCTGCTTACTTCAA
TGACTCACAGAGGCAGGCCACCAAGGATGCTGGTGTCATTGCTGGGCTTA
ATGTGATGCGTATCATCAATGAGCCCACTGCTGCTGCCATTGCTTATGGC
CTTGACAAGAAGGCTACTAGTGTGGGTGAGAAGAATGTGTTGATCTTTGA
TTTGGGTGGTGGTACTTTTGATGTGTCGTTGCTCACTATTGAGGAGGGAA
TCTTTGAAGTGAAGGCTACTGCTGGAGACACTCATCTTGGTGGTGAGGAT
TTTGATAACAGAATGGTGAATCATTTTGTTCAGGAGTTTAAGAGGAAGAA
ACAGAANGATATTAGTGGCAACCCTAGAGCTCTTAGGAGATTGAGGACTG
CTT
back to top