FC875593

Overview
NameFC875593
Unique NameFC875593
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length754
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13233 contig Ccv1_Contig13233:240..994. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_AGRRK (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=sucC PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.089e-38
Identity = 96/239 (40.17%), Postives = 133/239 (55.65%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKS---GLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQ   L+  +G  V  G+A+ S DE + A + +       VVKSQI AGGRG G FK      KGGV + K  E+V   +  MLG  LVTKQTGP GK V+++Y+ +   +  E+Y +I++DR       +  ++GG  IE +A   P  I+ V ID   G+T  D+  + D L  + A R D  +    LYK F E D  LLE+NPL   +  +L   DAK++FD NA FR +
Sbjct:    1 MNIHEYQAKALLKSFGAPVADGVAIFSADEAEAAAKQL--PGPLYVVKSQIHAGGRGKGKFKELSPDAKGGVRLAKSIEDVVANSKDMLGNTLVTKQTGPAGKQVNRLYIEDGADIDRELYLSILVDRSVGQVAFVVSTEGGMDIETVAHDTPEKIITVAIDPAAGVTAADSTAISDALKLEGAAREDGAKLFPILYKAFVEKDMALLEVNPLIVMTNGRLRVLDAKVSFDGNALFRHE 237          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_DESOH (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=sucC PE=3 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.422e-38
Identity = 97/241 (40.25%), Postives = 140/241 (58.09%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDV--FPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            + IHE+Q  EL   YGI  P+G  V + +   +A  ++  FP    +VVK+QI AGGRG G       GGV + K  +E + LAG MLG  LVT QTGP+G +V KV + + +S+  E+Y +++ DR+TAG +I+    GG  IE +AE  P  I+KV ++   G++     +   GL           + V  L+KLF + D +L+EINPL  T+ K ++A DAK+NFDD+A FR K  L
Sbjct:    1 MKIHEFQTKELFRTYGIPTPEGRMVNTAEAAGEAAGELGGFP----VVVKAQIHAGGRGKG-------GGVKLAKSADEAKSLAGAMLGSRLVTPQTGPEGTLVQKVLVEQGVSIAKELYLSVVADRETAGIVIMASEAGGMDIEAVAETTPEKILKVFVNPLAGLSAFHCRQAAYGLNLPAEAIKPFTQVVSGLFKLFVDYDASLVEINPLILTTDKAVMALDAKINFDDSALFRHKDIL 230          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BACC4 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cereus (strain B4264) GN=sucC PE=3 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.422e-38
Identity = 93/239 (38.91%), Postives = 136/239 (56.90%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG  ++  YG++VP G    +V+E  +A +++  D    VVK+QI AGGRG         GGV + K  +EV   A  +LG  LVT QTGP+GK V ++ + E   +  E Y  ++LDR T+  +++   +GGT IE++AEK P  I K  ID   G+    A ++   +         A++ +  LY+ F E DC++ EINPL  T   +++A DAKLNFD NA +R K  L
Sbjct:    1 MNIHEYQGKAVLRSYGVSVPNGKVAFTVEEAVEAAKELGTD--VCVVKAQIHAGGRGKA-------GGVKVAKNLDEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQVVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNINIPKELVGQAVKFMMGLYRAFIEKDCSIAEINPLVTTGEGKVMALDAKLNFDSNALYRHKDIL 230          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BACC2 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cereus (strain G9842) GN=sucC PE=3 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.422e-38
Identity = 93/239 (38.91%), Postives = 136/239 (56.90%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG  ++  YG++VP G    +V+E  +A +++  D    VVK+QI AGGRG         GGV + K  +EV   A  +LG  LVT QTGP+GK V ++ + E   +  E Y  ++LDR T+  +++   +GGT IE++AEK P  I K  ID   G+    A ++   +         A++ +  LY+ F E DC++ EINPL  T   +++A DAKLNFD NA +R K  L
Sbjct:    1 MNIHEYQGKAVLRSYGVSVPNGKVAFTVEEAVEAAKELGTD--VCVVKAQIHAGGRGKA-------GGVKVAKNLDEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQVVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNIHIPKELVGQAVKFMMGLYRAFIEKDCSIAEINPLVTTGEGKVMALDAKLNFDSNALYRHKDIL 230          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_STACT (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus carnosus (strain TM300) GN=sucC PE=3 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.857e-38
Identity = 94/239 (39.33%), Postives = 133/239 (55.65%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG E+    G+ VP+G    + +E  +  +++  D    VVK+QI AGGRG         GGV I K   EVE  A ++LG+ LVT QTGP+GK V ++Y+ E   +  E Y   ++DR T    ++   +GGT IE++A K P  I K  ID   G+    A ++   +       N A + +  LY +F E DC+++EINPL  T    ++A DAK+NFDDNA FR K  L
Sbjct:    1 MNIHEYQGKEIFRSMGVPVPEGRVAFTAEEAVEKAKEL--DTDVYVVKAQIHAGGRGKA-------GGVKIAKSLSEVEAYANELLGKQLVTHQTGPEGKEVKRLYIEEGADIKKEYYVGFVIDRATDRVTLMASEEGGTEIEEVAAKSPEKIFKETIDPVVGLAPFQARRIAFNINIPKESINKAAKFLIALYNVFIEKDCSIVEINPLVLTGEGDVLALDAKINFDDNALFRHKDIL 230          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BORPD (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=sucC PE=3 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.857e-38
Identity = 91/241 (37.76%), Postives = 137/241 (56.85%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG EL+ ++G+ VP+G+   SVDE   A + +       VVK+QI AGGRG G       GGV + +  ++V  LA ++LG  LVT QTGP+G+ V+++Y+ +   +  E Y +++ DR T    II  S+GG  IE++A   P  I+   ID   G+  E A KV + +       + A +  +KLY  + ++D +L+EINPL   S   ++A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKELLKQFGVPVPRGIPAFSVDEAVAAAEKL--GGPVWVVKAQIHAGGRGKG-------GGVKLARSLDDVRKLASEILGMQLVTHQTGPEGQKVNRLYIEDGADIQKEYYVSLVTDRATQKVAIIASSEGGMDIEEVAHSTPEKIITEYIDPLTGLQAEQAKKVAESIGLSGGSADQAADVFQKLYTCYMDTDASLVEINPLNCDSKGNIIALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_WOLWR (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=sucC PE=3 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 2.425e-38
Identity = 96/236 (40.68%), Postives = 135/236 (57.20%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDG--LAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ  E++ K+ ++VPKG    S +EVK     +  D    VVK+QI AGGRG         GGV + K  EE +     M+G  LVT QTGP G+ V KVY+ E  S+  E Y ++++D K + PI I  S+GG  IE++A+  P  IVK  ID     T  D++K+     L+P+  ++   +   K +Y  F  +D + +EINPL ETS    +A DAK+NFDDNA +R
Sbjct:    1 MNIHEYQAKEVLHKFNVSVPKGFVATSAEEVKTQVSQLKSD--VFVVKAQIHAGGRGKA-------GGVKLAKSAEEAQQFVKDMIGMTLVTHQTGPSGQQVRKVYVEEGSSIKKEYYLSLVIDPKLSRPIFIFSSEGGMDIEEVAKNSPAKIVKFDID---SATSFDSSKLSSSFHLSPEQIEKITNV--AKNIYDAFIATDASQIEINPLVETSSGDFIALDAKINFDDNALYR 222          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_ERYLH (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Erythrobacter litoralis (strain HTCC2594) GN=sucC PE=3 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 2.425e-38
Identity = 97/240 (40.42%), Postives = 136/240 (56.67%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDE-VKKATQDVFPDHKELVVKSQILAGGRGLGTFKS---GLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +N+HEYQ  EL+AKYGI +P G A  +V+E V  A Q   P +   VVK+QI AGGRG G FK      KGGV + K  E+VE  A +MLG  LVT QTG +GK V+++Y+ + + + +E Y ++++DR +    +I  ++GG  IE++A   P  I  + ID   G        V   L         A +  K+LY  F + DC +LEINPL ET   QL+  D K++ D NA +R K
Sbjct:    1 MNLHEYQAKELLAKYGIGIPAGHAALTVEEAVAGAKQLPGPLY---VVKAQIHAGGRGKGKFKELGPDAKGGVRLAKSIEDVEASAREMLGNTLVTVQTGEEGKQVNRLYVTDGVDIASEYYLSMVVDRASGRVGMIVSTEGGMDIEEVAHSTPEKITTITIDPAQGFMPHHGRAVAFALKLSGDLNKQAQKLAKQLYTAFMDLDCEMLEINPLVETEDGQLLVLDTKMSIDGNALYRHK 237          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_DESAH (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=sucC PE=3 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 2.425e-38
Identity = 97/238 (40.76%), Postives = 135/238 (56.72%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDV--FPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIV-KKEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            + IHEYQ   L   +G+ VP G    SV+E     + +  +P    +VVK+QI AGGRG G       GGV +   +EE    AG++LG  LVT QTGPQG+ V K+ +     +  E+Y +I++DR TAG +I+   +GG  IE +A K P  I+KV +D   GI      +V  GL    A   +    +K LY LF ++DC+LLEINPL  TS  +++A DAK++ D NA FR K
Sbjct:    1 MKIHEYQAKALFRTFGVPVPDGGVAFSVEEAVDVARGLGGYP----VVVKAQIHAGGRGKG-------GGVKLAASEEEARRFAGEILGMTLVTHQTGPQGREVKKLLVEAGQKIAKELYLSILVDRATAGIVIMASQEGGMDIETVAAKTPEKIIKVRVDPLTGIQGYYLRQVGFGLGLPKAALKEFSALLKNLYTLFVKNDCSLLEINPLILTSDDRVMALDAKVDIDSNALFRHK 227          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BACWK (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus weihenstephanensis (strain KBAB4) GN=sucC PE=3 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 2.425e-38
Identity = 93/239 (38.91%), Postives = 135/239 (56.49%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG  ++  YG++VP G    +V+E  +A +++  +    VVK+QI AGGRG         GGV + K  EEV   A  +LG  LVT QTGP+GK V ++ + E   +  E Y  ++LDR T+  +++   +GGT IE++AEK P  I K  ID   G+    A ++   +         A++ +  LY  F E DC++ EINPL  T   +++A DAKLNFD NA +R K  L
Sbjct:    1 MNIHEYQGKAVLRSYGVSVPNGKVAFTVEEAVEAAKELGTE--VCVVKAQIHAGGRGKA-------GGVKVAKNLEEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQVVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNINIPKELVGQAVKFMMGLYSAFIEKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRNKDIL 230          
The following BLAST results are available for this feature:
BLAST of FC875593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
SUCC_AGRRK1.089e-3840.17Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_DESOH1.422e-3840.25Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BACC41.422e-3838.91Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BACC21.422e-3838.91Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_STACT1.857e-3839.33Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BORPD1.857e-3837.76Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_WOLWR2.425e-3840.68Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_ERYLH2.425e-3840.42Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_DESAH2.425e-3840.76Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BACWK2.425e-3838.91Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F07EF CTVClemen1 Citrus clementina cDNA clone C31405F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875593 ID=FC875593|Name=FC875593|organism=Citrus clementina|type=EST|length=754bp
CCAATGGCAGCAACAGCAGCTCCGCCGTCTCAATATCCACGAATATCAGG
GGGCTGAGTTGATGGCCAAATATGGAATCAATGTGCCCAAAGGACTCGCT
GTTGCTTCTGTTGATGAAGTCAAAAAGGCTACTCAGGATGTTTTTCCCGA
TCATAAGGAGCTGGTGGTTAAGAGCCAAATTTTGGCTGGTGGGAGAGGCT
TGGGTACTTTTAAGTCTGGTCTTAAGGGTGGGGTTCACATTGTTAAGAAA
GAAGAAGTTGAAGATTTAGCTGGGAAGATGCTTGGACAGATACTTGTCAC
CAAACAAACTGGTCCACAAGGCAAAATTGTCAGCAAGGTTTATTTGTGTG
AAAAGTTGTCACTTGTCAATGAGATGTACTTTGCTATCATGTTGGATCGT
AAAACTGCTGGCCCTATAATAATTGGTTGCAGCAAGGGAGGAACCAGCAT
TGAAGACCTTGCTGAGAAATATCCTAACATGATTGTTAAGGTGCCTATTG
ATGTTTTCAATGGAATCACTGATGAAGATGCTGCTAAGGTTGTTGATGGT
TTGGCGCCCAAGGTTGCTGATAGAAATGATGCAATTGAACAAGTGAAGAA
ACTGTATAAACTCTTTTGTGAGAGTGACTGCACATTATTGGAAATCAATC
CTCTAGCAGAGACTTCTGGTAAGCAGTTGGTGGCTGCTGATGCTAAGTTG
AATTTTGATGATAATGCTGCCTTCCGTCAGAAGAGATATTTGCTCTTCGT
GACC
back to top