FC875593

Overview
NameFC875593
Unique NameFC875593
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length754
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13233 contig Ccv1_Contig13233:240..994. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_LEPBA (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=sucC PE=3 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 4.136e-38
Identity = 87/234 (37.18%), Postives = 132/234 (56.41%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVK-KEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            + +HEYQ  E++ ++  NVP G  + +V + +KA  +V      +VVK+QI AGGRG G       GGV + K K++ +  A K+LG  L+T QTGP+GK V KVYL + L +  E Y +I+LDR     II+  ++GG  IE++AE +P  I+K+ ID   GI      ++   L      +      V  +Y  + + D  LLEINPL  T   +++A D K++ D+NA +R
Sbjct:    1 MKVHEYQAKEILRRHNANVPFGKVIDAVGDFEKAYNEVVQKSPVVVVKAQIHAGGRGKG-------GGVKVAKTKDDAKAAAEKILGMQLITPQTGPEGKKVLKVYLEQGLEIAKEYYLSILLDRAIRKTIIMASTEGGMEIEEVAETHPEKIIKIQIDPGIGIQGSQVRELAFALGIPTEAQKSFTALVNSVYNAYIKEDAALLEINPLILTKQNEIIAGDCKMDLDENALYR 227          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_PELUB (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pelagibacter ubique GN=sucC PE=3 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 5.402e-38
Identity = 86/234 (36.75%), Postives = 141/234 (60.26%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHE+Q  +++ KYG  VP+G+   +VDE+ +  + +  +  + V+K+QI AGGRG         GGV I+   +E+   A ++LG+ LVT QTGP G+ V ++Y+ E  ++  E Y + ++DR ++  + I   +GG  IE++AEK P  I+   ID+ + I+D D  K++   A     +  AI  +K +YK+F  +D  ++E+NPL  T  K+++  DAK+NFD NA FR
Sbjct:    1 MNIHEHQAKQILKKYGAVVPEGVFAFTVDELIEKAKSLKTE--KFVLKAQIHAGGRGKA-------GGVKILNTIDELSVAAKELLGKTLVTHQTGPAGREVKRLYVEESSNIDKEFYLSCLVDRASSKIVFISSDQGGMDIEEVAEKTPEKIITTKIDITDEISDADCEKIIAIYALADDAKKQAIALIKSVYKMFLGTDANMVEVNPLILTKEKKIICLDAKVNFDSNALFR 225          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_SPHWW (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=sucC PE=3 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 7.056e-38
Identity = 94/237 (39.66%), Postives = 137/237 (57.81%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ  EL+AK+G+ VP G A  +VDE  +A + +       VVK+QI AGGRG G FK   +  KGGV + K  +EV+  A  MLG  LVT QTG  GK V+++Y+ +   + +E Y ++++DRKT    +I  ++GG  IE +A   P  I  + ID   G        V   L  K      A++  ++LY  F  +D ++LE+NPL ET+  +L+  DAK++FD NA +R
Sbjct:    1 MNIHEYQAKELLAKFGVAVPAGHAALTVDEAVEAAKKL--PGPIWVVKAQIHAGGRGKGKFKELPADAKGGVRLSKSIDEVKANAADMLGNTLVTIQTGEAGKQVNRLYVTDGADIKSEYYLSMLVDRKTGRIAMIVSTEGGMDIEQVAHDTPEKIRTIVIDPAEGFQPHHGRAVAFALKLKGDLNKQAVKLAEQLYNAFIATDMSMLEVNPLVETTDGKLLVLDAKVSFDSNALYR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BACSK (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus clausii (strain KSM-K16) GN=sucC PE=3 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 7.056e-38
Identity = 91/239 (38.08%), Postives = 136/239 (56.90%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG E++  YG+ VP G    SVDE  +A +++       VVK+QI AGGRG         GGV + K  +EV   A ++LG+ LVT QTGP GK V ++ + E   + +E Y  +++DR T+  +++   +GGT IE++AEK P  I K  ID   G+    A ++   +         A++ +  LY++F + D ++ EINPL  T   +++A DAK NFD NA +R K  L
Sbjct:    1 MNIHEYQGKEILRSYGVAVPNGKVAFSVDEAVEAAKEL--GSSVSVVKAQIHAGGRGKA-------GGVKVAKNLDEVRTYAEEILGKTLVTHQTGPAGKEVKRLLIEEGCDIKSEYYIGLVVDRATSSVVLMASEEGGTEIEEVAEKTPEKIFKEVIDPAVGLQGFQARRIAFNINIPKELVGQAVKFMMGLYQVFVDKDASIAEINPLVTTGDGKVMALDAKFNFDSNALYRHKDIL 230          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BACCR (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cereus (strain ATCC 14579 / DSM 31) GN=sucC PE=3 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 7.056e-38
Identity = 92/239 (38.49%), Postives = 135/239 (56.49%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG  ++  YG++VP G    +V+E  +A +++  D    V K+QI AGGRG         GGV + K  +EV   A  +LG  LVT QTGP+GK V ++ + E   +  E Y  ++LDR T+  +++   +GGT IE++AEK P  I K  ID   G+    A ++   +         A++ +  LY+ F E DC++ EINPL  T   +++A DAKLNFD NA +R K  L
Sbjct:    1 MNIHEYQGKAVLRSYGVSVPNGKVAFTVEEAVEAAKELGTD--VCVEKAQIHAGGRGKA-------GGVKVAKNLDEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQVVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNINIPKELVGQAVKFMMGLYRAFIEKDCSIAEINPLVTTGEGKVMALDAKLNFDSNALYRHKDIL 230          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_ANAMM (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Anaplasma marginale (strain St. Maries) GN=sucC PE=3 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 7.056e-38
Identity = 91/236 (38.56%), Postives = 140/236 (59.32%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVK-KEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVD--GLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +N+HE+Q   +++ +G+ VP+G+ V SV+EV +   D+ P    + VK+QI AGGRG         GGV I K K+EV+ L  +ML  +L+T QT P+G+ V+KVYL E + +  E Y + ++DR      II  S+GG  IE +A++ PNM+  V +D   G       ++    GL PK    +  +   +K+YK+  E+D + +EINP+AETS  + +A DAK+ FDDN  +R
Sbjct:    1 MNVHEFQAKGVLSSFGVTVPRGVVVESVEEVDRLLGDLAPGL--VAVKAQIHAGGRGKA-------GGVKIGKTKDEVKSLVKQMLHSVLITHQTSPEGQKVNKVYLEEGVDIGKEYYISAVVDRSVGRVSIIFSSEGGVDIETVAKERPNMVSVVHVDPLYGFRSFHGQELCRRFGLGPKQV--SGVVSMARKIYKVLVETDASQVEINPMAETSSGEFLALDAKIAFDDNGLYR 225          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_WOLPM (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Wolbachia pipientis wMel GN=sucC PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 9.215e-38
Identity = 97/236 (41.10%), Postives = 134/236 (56.78%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVD--GLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ  E+  K+ + VPKG    S +EVK     +  D    VVK+QI AGGRG         GGV + K  EE +     M+G  LVT QTGP G+ V KVY+ E  S+  E Y ++++D K + PI I  S+GG  IE++A+  P  IVK  ID     T  D++K+     L+P+  ++   I   KK+Y  F  +D + +EINPL ET+    +A DAK+NFDDNA +R
Sbjct:    1 MNIHEYQAKEVFHKFNVPVPKGFVATSAEEVKTQVSQLKSD--VFVVKAQIHAGGRGKA-------GGVKLAKSVEEAQQFVKDMIGMTLVTHQTGPSGQQVRKVYVEEGSSIKKEYYLSLVIDPKLSRPIFIFSSEGGMDIEEVAKNSPAKIVKFDID---PATSFDSSKLSSRFHLSPEQIEKISNI--AKKIYDAFIATDASQIEINPLVETNSGDFIALDAKINFDDNALYR 222          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RALEH (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sucC PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 9.215e-38
Identity = 94/245 (38.37%), Postives = 143/245 (58.37%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKK----LYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            +NIHEYQG E++ KY + VP+G+   SVDE  KA + +       VVK+QI AGGRG G       GGV + K  ++V+  A  +LG  LVT QTGP+GK V+++ + E   +  E+Y ++++DR +    ++  S+GG  IE++A   P  I  + I+   G+TD +A    D +A K+   + ++ Q ++    LYK F E+D +L EINPL  T   +++A DAK NFD NA FR    + +
Sbjct:    1 MNIHEYQGKEILRKYNVPVPRGIPAFSVDEALKAAETL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSIDDVKTYASNILGMQLVTHQTGPEGKKVNRLLIEEGADIKKELYVSLVVDRVSQKVALMASSEGGMDIEEVAAHSPEKIHTLIIEPSVGLTDAEA----DDIARKIGVPDTSVAQARQALQGLYKAFYETDASLAEINPLILTGDGKVIALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_SORC5 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Sorangium cellulosum (strain So ce56) GN=sucC PE=3 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.204e-37
Identity = 96/239 (40.17%), Postives = 133/239 (55.65%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPD--HKELVVKSQILAGGRGLGTFKSGLKGGVHIVK--KEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAK--VVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            + IHEYQG +L A+YG+ VPKG       EV      +     +  +VVK+QI AGGRG G       GGV + K    E   LA K+LG  LVTKQTGP+G+ V ++Y+ + L +  E+YFA+++DR+     +I  ++GG  IE++A   P  I K+ ID   G+      +  +  GL  K   R   ++ V  LY  F   DC+LLEINPL  T    + A DAK++FDDNA FR
Sbjct:    1 MKIHEYQGKQLFARYGVPVPKGEPAFQASEVAPIADRLIAQTGNPVVVVKAQIHAGGRGKG-------GGVKVAKGGSAEATALAEKILGMQLVTKQTGPEGQKVRRLYIEQGLDIARELYFAMLVDRERRRIAVIASTEGGMDIEEVAHSTPEKIYKLFIDPVLGLAPYQGRQLAIALGLTAKETQR-QFLKLVASLYACFTAEDCSLLEINPLVVTGAGDVFALDAKVSFDDNAEFR 231          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BDEBA (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bdellovibrio bacteriovorus GN=sucC PE=3 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.204e-37
Identity = 90/234 (38.46%), Postives = 133/234 (56.84%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ  E++ K+G+   KG    S +E   A +++       VVK+QI AGGRG G       GGV + K  +EV +   KM+G  LVT QTGP+GK+V KV++ +  ++  E Y A ++DR T    ++  S+GG  IE++AE  P+ I KV ID   G+    A ++   +  + A  N A++    LY  F  +DC++ EINPL  T    ++  DAK+NFD N+ FR
Sbjct:    1 MNIHEYQAKEVLRKFGVATLKGKLAHSPEEAVAAAKEI--GGSVWVVKAQIHAGGRGKG-------GGVKVAKSLDEVSEFTKKMIGMTLVTHQTGPEGKVVQKVFIEQGCNIAKEYYVACLIDRATGRAAMMASSEGGMDIEEVAEHNPDAIKKVDIDPTVGLMPFQARELAFQIGMEPAIVNKAVKFFAGLYNAFVATDCSIAEINPLVVTKEGDVLCLDAKMNFDSNSLFR 225          
The following BLAST results are available for this feature:
BLAST of FC875593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
SUCC_LEPBA4.136e-3837.18Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_PELUB5.402e-3836.75Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_SPHWW7.056e-3839.66Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BACSK7.056e-3838.08Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BACCR7.056e-3838.49Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_ANAMM7.056e-3838.56Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_WOLPM9.215e-3841.10Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RALEH9.215e-3838.37Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_SORC51.204e-3740.17Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BDEBA1.204e-3738.46Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F07EF CTVClemen1 Citrus clementina cDNA clone C31405F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875593 ID=FC875593|Name=FC875593|organism=Citrus clementina|type=EST|length=754bp
CCAATGGCAGCAACAGCAGCTCCGCCGTCTCAATATCCACGAATATCAGG
GGGCTGAGTTGATGGCCAAATATGGAATCAATGTGCCCAAAGGACTCGCT
GTTGCTTCTGTTGATGAAGTCAAAAAGGCTACTCAGGATGTTTTTCCCGA
TCATAAGGAGCTGGTGGTTAAGAGCCAAATTTTGGCTGGTGGGAGAGGCT
TGGGTACTTTTAAGTCTGGTCTTAAGGGTGGGGTTCACATTGTTAAGAAA
GAAGAAGTTGAAGATTTAGCTGGGAAGATGCTTGGACAGATACTTGTCAC
CAAACAAACTGGTCCACAAGGCAAAATTGTCAGCAAGGTTTATTTGTGTG
AAAAGTTGTCACTTGTCAATGAGATGTACTTTGCTATCATGTTGGATCGT
AAAACTGCTGGCCCTATAATAATTGGTTGCAGCAAGGGAGGAACCAGCAT
TGAAGACCTTGCTGAGAAATATCCTAACATGATTGTTAAGGTGCCTATTG
ATGTTTTCAATGGAATCACTGATGAAGATGCTGCTAAGGTTGTTGATGGT
TTGGCGCCCAAGGTTGCTGATAGAAATGATGCAATTGAACAAGTGAAGAA
ACTGTATAAACTCTTTTGTGAGAGTGACTGCACATTATTGGAAATCAATC
CTCTAGCAGAGACTTCTGGTAAGCAGTTGGTGGCTGCTGATGCTAAGTTG
AATTTTGATGATAATGCTGCCTTCCGTCAGAAGAGATATTTGCTCTTCGT
GACC
back to top