FC875593

Overview
NameFC875593
Unique NameFC875593
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length754
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13233 contig Ccv1_Contig13233:240..994. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RHOP5 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodopseudomonas palustris (strain BisA53) GN=sucC PE=3 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 3.277e-35
Identity = 88/238 (36.97%), Postives = 132/238 (55.46%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQ 730
            +NIHEYQ   ++  +G+++ KG+A+    E + A + +       VVKSQI AGGRG G FK   +G +GGV + K  +EV+  A +MLG  LVT QTGP GK V+++Y+ E  ++  E Y ++++DR T+    +  ++GG +IED+A   P  I+   +D   GI       V   L         A +   +LY  F   D  +LEINPL  T   +L   DAK++FD N+ +RQ
Sbjct:    1 MNIHEYQAKAVLQPFGVSLSKGVAILKASEAEAAAKQL--PGPVWVVKSQIHAGGRGKGKFKEASAGSQGGVRLAKSIDEVKQFAQEMLGATLVTLQTGPAGKQVNRLYIEEGSAIDKEFYLSLLVDRATSRVSFVVSTEGGMNIEDVAHDTPEKIISFSVDPATGIMPHHGRIVAKTLGLTGELAKQAGKLTTQLYTAFVAKDMEMLEINPLVLTKDGELRCLDAKMSFDSNSLYRQ 236          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RHILO (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhizobium loti GN=sucC PE=3 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 3.277e-35
Identity = 92/237 (38.82%), Postives = 128/237 (54.01%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKS---GLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQG  L+  +G  V +G+ V    E + A + +       VVKSQI AGGRG G FK      KGGV + K   +V   A +MLG  LVTKQTGP GK V+++Y+ +   +  E+Y +I++DR       +  ++GG  IE +A   P  ++ V ID   G+T +D  K+   L        D       LYK F E D +LLE+NPL      +L   DAK++FD+NA FR
Sbjct:    1 MNIHEYQGKALLKSFGAPVAEGVPVFKASEAEAAARAL--PGPLYVVKSQIHAGGRGKGKFKELSPDAKGGVRLAKSVADVVANANEMLGHTLVTKQTGPAGKQVNRLYIEDGADIERELYLSILVDRSVGRIAFVVSTEGGMDIEAVAHDTPEKVITVAIDPERGVTADDVKKLNAALKLDGDAAKDGGTLFPILYKAFIEKDMSLLEVNPLIVMKNGRLRVLDAKVSFDNNALFR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BRASO (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bradyrhizobium sp. (strain ORS278) GN=sucC PE=3 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 3.277e-35
Identity = 89/237 (37.55%), Postives = 130/237 (54.85%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   L+ ++G+ + KG+ V   ++   A + +       VVKSQI AGGRG G FK   +G KGGV + K  +EV   A +MLG  LVT QTGP GK V+++Y+ +   +  E Y ++++DR+T+    +  ++GG +IED+A + P  IV   +D   G+       V   L         A +   +LY  F   D  +LEINPL  T   QL   DAK++FD NA F+
Sbjct:    1 MNIHEYQAKALLHEFGVPISKGVPVLRPEDADAAAKTL--GGPVWVVKSQIHAGGRGKGKFKEASAGDKGGVRLAKSIDEVNTFARQMLGATLVTVQTGPDGKQVNRLYIEDGSDIDKEFYLSLLVDRETSKVAFVVSTEGGVNIEDVAHETPEKIVTFSVDPATGVMGHHGRAVAKALKLSGDLAKQAEKLTTQLYNAFVAKDMAMLEINPLVVTKQGQLRVLDAKVSFDSNALFK 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RHIEC (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=sucC PE=3 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 4.281e-35
Identity = 93/237 (39.24%), Postives = 128/237 (54.01%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKS---GLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   L+  YG  V +G+A+   +E + A + +       VVKSQI AGGRG G FK      KGGV + K  E+V   A +MLG  LVT QTG  GK V+++Y+ +   +  E+Y ++++DR       +  ++GG  IE +A   P  I  + ID   G+T  D AK+   L  + A   DA      LY+ F E D +LLEINPL       L   DAK++FD NA FR
Sbjct:    1 MNIHEYQAKALLKGYGAPVAEGVAILKAEEAEAAAKSL--PGPLYVVKSQIHAGGRGKGKFKELSPEAKGGVRLAKSIEDVVANAKEMLGNTLVTAQTGEAGKQVNRLYIEDGADIDRELYCSLLVDRSVGKVAFVVSTEGGMDIEAVAHDTPEKIQTIAIDPETGVTAADVAKISAALKLEGAAAEDAKSLFPLLYRAFNEKDMSLLEINPLIVMKNGHLRVLDAKMSFDGNALFR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_NEOSM (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Neorickettsia sennetsu (strain Miyayama) GN=sucC PE=3 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 4.281e-35
Identity = 95/235 (40.43%), Postives = 126/235 (53.62%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFP-DHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ  E++   G+  P G  V    E  +  + +     K   VK+QI AGGRG         GGV I +  EE  D   KMLG  LVT QT P G+ V KVY+    S++ E Y ++++DR+ A   II   +GG  IE++A   P  I KV +D+  GI+D  A K+   L   +A        VKKLY LF   D + +EINPL   S  + +A DAKLNFDDNA +R
Sbjct:    1 MNIHEYQAKEILRVCGVPTPAGFLVQEDTETSEIAKSLARLGGKVFAVKAQIHAGGRGKA-------GGVVICRSVEEAIDNTKKMLGMNLVTHQTSPAGQKVRKVYIEAGQSILKEYYLSMVVDRENAKVAIIASEEGGMDIEEIARSTPEKIKKVFVDLSIGISDFHARKIGFELGLSLAQIKQFTPLVKKLYALFVTRDASQVEINPLIANSKGEFIALDAKLNFDDNALYR 228          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_AGRVS (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=sucC PE=3 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 4.281e-35
Identity = 89/239 (37.24%), Postives = 130/239 (54.39%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKS---GLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQ   L+  +G  V +G+A+ S DE + A + +       VVKSQI AGGRG G FK      KGGV +    +EV+    +MLG  LVT QTGP GK V+++Y+ +   +  E+Y ++++DR       +  ++GG  IE +A   P  I+ V ID   G+T  +   +   L  +   + DA +    LYK F E D  LLE+NPL      ++   DAK++FD NA FR +
Sbjct:    1 MNIHEYQAKALLKSFGAPVAEGVAIFSADEAEAAAKQL--PGPLYVVKSQIHAGGRGKGKFKELGPDAKGGVRLAFSIDEVKSHVAEMLGNTLVTNQTGPAGKQVNRLYIEDGADIERELYLSLLVDRAVGQVAFVVSTEGGMDIETVAHDTPEKIISVAIDPEAGVTAANLEALTAALLLEGEAKADAEKLFPILYKAFVEKDMALLEVNPLIVMKNGRMRVLDAKMSFDGNALFRHE 237          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RHIE6 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhizobium etli (strain CIAT 652) GN=sucC PE=3 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 5.591e-35
Identity = 93/237 (39.24%), Postives = 126/237 (53.16%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKS---GLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   L+  YG  V +G+A+   +E + A + +       VVKSQI AGGRG G FK      KGGV + K  E+V     +MLG  LVT QTG  GK V+++Y+ +   +  E+Y ++++DR       +  ++GG  IE +A   P  I  + ID   G+T  D AK+   L    A   DA      LYK F E D +LLEINPL       L   DAK++FD NA FR
Sbjct:    1 MNIHEYQAKALLKGYGAPVAEGVAILKAEEAEAAAKSL--PGPLYVVKSQIHAGGRGKGKFKELSPEAKGGVRLAKSVEDVVANVKEMLGNTLVTAQTGEAGKQVNRLYIEDGADIERELYCSLLVDRSVGKVAFVVSTEGGMDIEAVAHDTPEKIQTIAIDPETGVTAADVAKISSALKLDGAAGEDAKSLFPLLYKAFNEKDMSLLEINPLIVMKNGHLRVLDAKMSFDGNALFR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_SULSY (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=sucC PE=3 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 7.301e-35
Identity = 89/234 (38.03%), Postives = 130/234 (55.56%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            + +HE+Q  E+  KYG+ VP+G     V E  +A +++      +VVK+QI AGGRG         GGV + K  EEV+ +A ++LG+ L T QTGP+G  VS++Y+ E  ++  E Y AI LDR  + PII+  + GG  IE++A   P  I+   I+ F G+    A ++   L       N A      LYK++ E D +++EINPL  T    +V  DAK+ FDDN  FR
Sbjct:    1 MKVHEHQAKEIFRKYGLPVPRGYPAFDVKEAVEAAEEL--GTWPVVVKAQIHAGGRGKA-------GGVKLAKSIEEVQQIASELLGKKLATFQTGPEGLPVSRLYIEEATAIDKEFYVAITLDRSKSKPIIMVSAAGGMEIEEVAATNPEAIITQTIEPFIGLRSYHARELALKLGLPKNLLNKAASIFTTLYKIYIELDASMVEINPLVLTKDGNIVILDAKIEFDDNGLFR 225          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_LEPBL (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=sucC PE=3 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 7.301e-35
Identity = 84/236 (35.59%), Postives = 129/236 (54.66%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDH--KELVVKSQILAGGRGLGTFKSGLKGGVHIVK-KEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            + IHEYQ  E++ ++  NVP G+ +   +   KA  +V        +VVK+QI AGGRG G       GGV + K KE+      K+LG  L+T QTGP+GK V KVYL + + +  E Y +I+LDR     I++  ++GG  IE++AE +P  I+K+ +D   G+    A ++   L             V  +Y  + + D +LLEINPL  T   +++A D K++ D+NA +R
Sbjct:    1 MKIHEYQAKEILRRHKANVPFGIVIDKKENASKAHDEVTSKTGGSVVVVKAQIHAGGRGKG-------GGVKVTKTKEDATAAVDKILGMQLITPQTGPEGKKVLKVYLEQGIDIAKEYYLSILLDRSIRKTILMASTEGGMEIEEVAETHPEKILKIAVDPGIGLQVNQARQLAFELGLPAESHKSFQSLVMAIYDAYIKEDASLLEINPLILTKQNEIIAGDCKIDLDENALYR 229          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_LEPBJ (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=sucC PE=3 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 7.301e-35
Identity = 84/236 (35.59%), Postives = 129/236 (54.66%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDH--KELVVKSQILAGGRGLGTFKSGLKGGVHIVK-KEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            + IHEYQ  E++ ++  NVP G+ +   +   KA  +V        +VVK+QI AGGRG G       GGV + K KE+      K+LG  L+T QTGP+GK V KVYL + + +  E Y +I+LDR     I++  ++GG  IE++AE +P  I+K+ +D   G+    A ++   L             V  +Y  + + D +LLEINPL  T   +++A D K++ D+NA +R
Sbjct:    1 MKIHEYQAKEILRRHKANVPFGIVIDKKENASKAHDEVTSKTGGSVVVVKAQIHAGGRGKG-------GGVKVTKTKEDATAAVDKILGMQLITPQTGPEGKKVLKVYLEQGIDIAKEYYLSILLDRSIRKTILMASTEGGMEIEEVAETHPEKILKIAVDPGIGLQVNQARQLAFELGLPAESHKSFQSLVMAIYDAYIKEDASLLEINPLILTKQNEIIAGDCKIDLDENALYR 229          
The following BLAST results are available for this feature:
BLAST of FC875593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
SUCC_RHOP53.277e-3536.97Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RHILO3.277e-3538.82Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BRASO3.277e-3537.55Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RHIEC4.281e-3539.24Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_NEOSM4.281e-3540.43Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_AGRVS4.281e-3537.24Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RHIE65.591e-3539.24Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_SULSY7.301e-3538.03Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_LEPBL7.301e-3535.59Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_LEPBJ7.301e-3535.59Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F07EF CTVClemen1 Citrus clementina cDNA clone C31405F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875593 ID=FC875593|Name=FC875593|organism=Citrus clementina|type=EST|length=754bp
CCAATGGCAGCAACAGCAGCTCCGCCGTCTCAATATCCACGAATATCAGG
GGGCTGAGTTGATGGCCAAATATGGAATCAATGTGCCCAAAGGACTCGCT
GTTGCTTCTGTTGATGAAGTCAAAAAGGCTACTCAGGATGTTTTTCCCGA
TCATAAGGAGCTGGTGGTTAAGAGCCAAATTTTGGCTGGTGGGAGAGGCT
TGGGTACTTTTAAGTCTGGTCTTAAGGGTGGGGTTCACATTGTTAAGAAA
GAAGAAGTTGAAGATTTAGCTGGGAAGATGCTTGGACAGATACTTGTCAC
CAAACAAACTGGTCCACAAGGCAAAATTGTCAGCAAGGTTTATTTGTGTG
AAAAGTTGTCACTTGTCAATGAGATGTACTTTGCTATCATGTTGGATCGT
AAAACTGCTGGCCCTATAATAATTGGTTGCAGCAAGGGAGGAACCAGCAT
TGAAGACCTTGCTGAGAAATATCCTAACATGATTGTTAAGGTGCCTATTG
ATGTTTTCAATGGAATCACTGATGAAGATGCTGCTAAGGTTGTTGATGGT
TTGGCGCCCAAGGTTGCTGATAGAAATGATGCAATTGAACAAGTGAAGAA
ACTGTATAAACTCTTTTGTGAGAGTGACTGCACATTATTGGAAATCAATC
CTCTAGCAGAGACTTCTGGTAAGCAGTTGGTGGCTGCTGATGCTAAGTTG
AATTTTGATGATAATGCTGCCTTCCGTCAGAAGAGATATTTGCTCTTCGT
GACC
back to top