FC875593

Overview
NameFC875593
Unique NameFC875593
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length754
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13233 contig Ccv1_Contig13233:240..994. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_GEOSL (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Geobacter sulfurreducens GN=sucC PE=3 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 3.384e-40
Identity = 90/238 (37.82%), Postives = 139/238 (58.40%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRY 739
            +NIHEYQ  E+++ YGI VP+G    + D+V++A +++       V+K+QI AGGRG         GGV +V   E+ +D   ++ G+ L+T QTGP+G  V ++ + E + +  E Y +I LDR T+   +I  ++GG  IE++ +K P+ I  + ID + G+    A ++   L        D +E +  LYK+  E DC+L+EINPL  T    L+A DAK+NFDDNA FR + Y
Sbjct:    1 MNIHEYQAKEILSAYGIPVPRGRVALTSDQVERAAKEM---GGRCVIKAQIYAGGRGKA-------GGVKLVHHPEQAQDYGKELFGRRLITPQTGPEGLKVRRILVEEAVEIAREFYLSITLDRSTSRYCLIASAEGGVDIEEVVQKSPDKIHVLTIDPYTGLRPFQARRIALALGLSGTLCEDCVELMLNLYKVVLEKDCSLVEINPLVVTRAGWLMAMDAKINFDDNAIFRHREY 228          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_CHLTE (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlorobium tepidum GN=sucC PE=3 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 3.384e-40
Identity = 91/240 (37.92%), Postives = 142/240 (59.17%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKE--LVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRY 739
            +NIHEYQG  ++ ++G+ VPKG+   S +E K+A + +F +     +VVK+QI AGGRG         GGV + K  EEV ++A KMLG  LVT QTGP+GK V ++ + E +++  E Y  I LDR T+  +++  ++GG  IE +AE+ P  ++K+ +D   G+    A K    L  +     + ++ ++ LY  +   D +L EINPL  T   +++A DAK+NFDDNA +R   +
Sbjct:    1 MNIHEYQGKGILKQFGVAVPKGIVAFSAEEAKQAAEQLFEEQSSPVVVVKAQIHAGGRGKA-------GGVKLAKSPEEVFEIAQKMLGATLVTHQTGPEGKEVRRLLIEEGMNIDKEFYLGITLDRTTSSNVLMVSTEGGMEIEKVAEETPEKLLKIHVDPVYGLQGFQARKAAFFLGLQGEQFRNGVKFIEALYNAYTTIDASLAEINPLVITKEGRVLALDAKINFDDNALYRHSDF 233          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BORPE (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bordetella pertussis GN=sucC PE=3 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 3.384e-40
Identity = 95/241 (39.42%), Postives = 139/241 (57.68%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG EL+ ++G+ VP+G+   SVDE   A + +       VVK+QI AGGRG G       GGV + +  +EV  L+ ++LG  LVT QTGPQG+ V ++ + E   +  E Y  I+ DR T    ++  S+GG  IE++A   P  I+KV +D   G+TD +AA++  G+    A    A  + +KLYK + ++D +L EINPL  T    ++A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKELLKQFGVTVPRGIPAFSVDEAVAAAEKL--GGPVWVVKAQIHAGGRGKG-------GGVKLGRSIDEVRQLSSEILGMQLVTHQTGPQGQKVRRLLIEEGADIKKEYYVGIVTDRGTQRVCVMASSEGGMDIEEVAAHSPEKILKVFVDPAAGLTDAEAAELARGIGVPEASVGKAAAEFQKLYKAYWDTDASLAEINPLILTGSGDIIALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BORPA (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bordetella parapertussis GN=sucC PE=3 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 3.384e-40
Identity = 95/241 (39.42%), Postives = 139/241 (57.68%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG EL+ ++G+ VP+G+   SVDE   A + +       VVK+QI AGGRG G       GGV + +  +EV  L+ ++LG  LVT QTGPQG+ V ++ + E   +  E Y  I+ DR T    ++  S+GG  IE++A   P  I+KV +D   G+TD +AA++  G+    A    A  + +KLYK + ++D +L EINPL  T    ++A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKELLKQFGVTVPRGIPAFSVDEAVAAAEKL--GGPVWVVKAQIHAGGRGKG-------GGVKLGRSIDEVRQLSSEILGMQLVTHQTGPQGQKVRRLLIEEGADIKKEYYVGIVTDRGTQRVCVMASSEGGMDIEEVAAHSPEKILKVFVDPAAGLTDAEAAELARGIGVPEASVGKAAAEFQKLYKAYWDTDASLAEINPLILTGSGDIIALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BORBR (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bordetella bronchiseptica GN=sucC PE=3 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 3.384e-40
Identity = 95/241 (39.42%), Postives = 139/241 (57.68%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG EL+ ++G+ VP+G+   SVDE   A + +       VVK+QI AGGRG G       GGV + +  +EV  L+ ++LG  LVT QTGPQG+ V ++ + E   +  E Y  I+ DR T    ++  S+GG  IE++A   P  I+KV +D   G+TD +AA++  G+    A    A  + +KLYK + ++D +L EINPL  T    ++A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKELLKQFGVTVPRGIPAFSVDEAVAAAEKL--GGPVWVVKAQIHAGGRGKG-------GGVKLGRSIDEVRQLSSEILGMQLVTHQTGPQGQKVRRLLIEEGADIKKEYYVGIVTDRGTQRVCVMASSEGGMDIEEVAAHSPEKILKVFVDPAAGLTDAEAAELARGIGVPEASVGKAAAEFQKLYKAYWDTDASLAEINPLILTGSGDIIALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_PELPB (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=sucC PE=3 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 4.419e-40
Identity = 91/240 (37.92%), Postives = 141/240 (58.75%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDH--KELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRY 739
            +NIHEYQG +++ K+G+ VP+G+   S +E K+A + +F +     +V+K+QI AGGRG         GGV + K  EE  D+A +++G  L+T QTGP+GK V +V + E +++  E Y  I LDR T+  +++  ++GG  IE +AE+ P  ++K+ ID   G+    A +    L  K     +A+  +  LY  +   D  L EINPL  T   +++A DAK+NFDDNA FR K +
Sbjct:    1 MNIHEYQGKDILRKFGVAVPRGIVAYSPEEAKQAAEQLFDELGCPVVVIKAQIHAGGRGKA-------GGVKLAKSPEESLDIAHQLIGMTLITHQTGPEGKEVRRVLVEEGMNIEKEFYVGITLDRSTSKNVLMVSTEGGMEIEKVAEETPERLLKIQIDPLFGMQGFQAREAAFFLGLKGEQFRNAVNFITALYNAYISIDAALAEINPLVVTKEGKVLALDAKINFDDNALFRHKEF 233          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_CHLPB (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlorobium phaeobacteroides (strain BS1) GN=sucC PE=3 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 4.419e-40
Identity = 90/241 (37.34%), Postives = 146/241 (60.58%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKE--LVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG +++ K+G++VPKG+   S  E ++A + +F + +   +VVK+QI AGGRG         GGV + +  EE  ++AG++LG  LVT QTGP+GK V ++ + E +++  E Y  I LDR T+  +++  ++GG  IE +AE+ P+ I+K+ ID  +G+    A +    L        + ++ +  LY  +   D +L EINPL  T+  +++A DAK+NFD NA +R K +L
Sbjct:    1 MNIHEYQGKDILRKFGVSVPKGIVAFSPAEARQAAEQLFEEQESNVVVVKAQIHAGGRGKA-------GGVKLAQSPEEAYEIAGQILGATLVTHQTGPEGKEVRRLLVEEGMNIEKEFYVGITLDRATSNNVLMVSTEGGMEIEKVAEETPDKILKIQIDPLHGLLGFQARQAAFFLELDGERFKNGVKFITALYNAYVSIDASLAEINPLVVTAEGRVLALDAKINFDSNALYRHKDFL 234          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BACA2 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus amyloliquefaciens (strain FZB42) GN=sucC PE=3 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 4.419e-40
Identity = 93/236 (39.41%), Postives = 138/236 (58.47%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVK-KEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQG E++ KYG++VP+G    + +E  +  + +       VVK+QI AGGRG         GGV I K K+EV++ A ++LG+ LVT QTGP G+++ ++ + E   +  E Y  ++LDR T+  +++   +GGT IE++AEK P  I K  ID   G+    A ++   +         A + +  LYK F E DC++ EINPL  T    ++A DAKLNFD NA +RQK
Sbjct:    1 MNIHEYQGKEVLRKYGVSVPEGKVAFTAEEAVEKAESL--SSSVYVVKAQIHAGGRGKA-------GGVKIAKTKDEVKEYAEELLGKTLVTHQTGPDGQVIKRLLIEEGCDIKKEYYVGLVLDRATSRIVLMASEEGGTEIEEVAEKTPEKIKKAVIDPAVGLQGYQAREIAFAINIPKELVGKAAKFMLGLYKAFVEKDCSIAEINPLVVTGDGNVMALDAKLNFDSNALYRQK 227          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RHOS5 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=sucC PE=3 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 5.772e-40
Identity = 96/238 (40.34%), Postives = 135/238 (56.72%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKKE-EVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQ 730
            +NIHEYQ   L+  YG  V  G  V   DE K A  ++       VVK+QI AGGRG G FK   +G KGGV + K   E  +LA +MLG+ LVT QTGP GK V+++Y+ E   +  E+Y A+++DR T+    +  ++GG  IE++A   P  IV   +D  +G++D    +V   L  + A     ++ VK LY+ F E D  +LEINPL   +   L   DAK+ FD+NA +RQ
Sbjct:    1 MNIHEYQAKALLRSYGAPVSDGRVVLKADEAKSAAGEL--GGPLWVVKAQIHAGGRGKGKFKEPEAGEKGGVRLAKSVGEAAELAKQMLGRTLVTHQTGPSGKQVNRIYIEEGSDIARELYLALLVDRGTSRISFVVSTEGGMDIEEVAASTPEKIVSFSVDPASGLSDFHGRRVAFALGLEGAQVKQCVQLVKNLYRAFVEKDMEMLEINPLIVMTDGNLKVLDAKVGFDNNALYRQ 236          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BURM1 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=sucC PE=3 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 5.772e-40
Identity = 97/245 (39.59%), Postives = 146/245 (59.59%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKK----LYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG E++ K+G+ VP+G    SVDE  K  +++       VVK+QI AGGRG G       GGV + K  E+V + A ++LG  LVT QTGP+G+ V+++ + E   +  E+Y ++++DR +   +++G S+GG  IE++AEK+P +I KV ++   G+ D  A    D LA K+     +I Q +     LYK F E+D +L EINPL  +   ++VA DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAEEL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSLEQVREYANQILGMQLVTHQTGPEGQKVNRLLIEEGADIKQELYVSLVVDRISQKIVLMGSSEGGMDIEEVAEKHPELIHKVIVEPSTGLLDSQA----DDLATKIGVPAASIPQARAILQGLYKAFWETDASLAEINPLNVSGDGKVVALDAKFNFDSNALFRHPEIVAY 232          
The following BLAST results are available for this feature:
BLAST of FC875593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
SUCC_GEOSL3.384e-4037.82Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_CHLTE3.384e-4037.92Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BORPE3.384e-4039.42Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BORPA3.384e-4039.42Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BORBR3.384e-4039.42Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_PELPB4.419e-4037.92Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_CHLPB4.419e-4037.34Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BACA24.419e-4039.41Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RHOS55.772e-4040.34Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BURM15.772e-4039.59Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F07EF CTVClemen1 Citrus clementina cDNA clone C31405F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875593 ID=FC875593|Name=FC875593|organism=Citrus clementina|type=EST|length=754bp
CCAATGGCAGCAACAGCAGCTCCGCCGTCTCAATATCCACGAATATCAGG
GGGCTGAGTTGATGGCCAAATATGGAATCAATGTGCCCAAAGGACTCGCT
GTTGCTTCTGTTGATGAAGTCAAAAAGGCTACTCAGGATGTTTTTCCCGA
TCATAAGGAGCTGGTGGTTAAGAGCCAAATTTTGGCTGGTGGGAGAGGCT
TGGGTACTTTTAAGTCTGGTCTTAAGGGTGGGGTTCACATTGTTAAGAAA
GAAGAAGTTGAAGATTTAGCTGGGAAGATGCTTGGACAGATACTTGTCAC
CAAACAAACTGGTCCACAAGGCAAAATTGTCAGCAAGGTTTATTTGTGTG
AAAAGTTGTCACTTGTCAATGAGATGTACTTTGCTATCATGTTGGATCGT
AAAACTGCTGGCCCTATAATAATTGGTTGCAGCAAGGGAGGAACCAGCAT
TGAAGACCTTGCTGAGAAATATCCTAACATGATTGTTAAGGTGCCTATTG
ATGTTTTCAATGGAATCACTGATGAAGATGCTGCTAAGGTTGTTGATGGT
TTGGCGCCCAAGGTTGCTGATAGAAATGATGCAATTGAACAAGTGAAGAA
ACTGTATAAACTCTTTTGTGAGAGTGACTGCACATTATTGGAAATCAATC
CTCTAGCAGAGACTTCTGGTAAGCAGTTGGTGGCTGCTGATGCTAAGTTG
AATTTTGATGATAATGCTGCCTTCCGTCAGAAGAGATATTTGCTCTTCGT
GACC
back to top