FC876179

Overview
NameFC876179
Unique NameFC876179
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length698
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10304 contig Ccv1_Contig10304:1..698. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_CHLP8 (Glutamate-1-semialdehyde 2,1-aminomutase OS=Chlorobaculum parvum (strain NCIB 8327) GN=hemL PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 9.154e-50
Identity = 95/162 (58.64%), Postives = 120/162 (74.07%), Query Frame = 2
Query:  212 LKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKK-GTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLG 694
            L  S E F  AK+ +PGGVNSPVRAFKSVGG PI     +G++M D+DGN Y+DYVGSWGP I+G    ++ AA+  T++  GTSFG P  +E  +AE++   VPS+EMVR VNSGTEA M  +RLAR +TG+++I +FEGCYHGH D FL+KAGSGV TLG
Sbjct:    4 LTRSAELFEKAKKFIPGGVNSPVRAFKSVGGTPIYMAKGQGAYMTDVDGNTYLDYVGSWGPFILGSMHPRLTAAIEYTLRNIGTSFGTPIEIEIEIAELLCQIVPSLEMVRMVNSGTEATMSAVRLARGYTGKDKIIKFEGCYHGHGDSFLIKAGSGVLTLG 165          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_CELJU (Glutamate-1-semialdehyde 2,1-aminomutase OS=Cellvibrio japonicus (strain Ueda107) GN=hemL PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 9.154e-50
Identity = 91/162 (56.17%), Postives = 119/162 (73.46%), Query Frame = 2
Query:  212 LKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            +  SEE F  A++ +PGGVNSPVRAFK+VGG P+ F+   G+++WD DG  YIDYV SWGP ++GHA  +V+  + +  K G SFGAP   E  LAE + S +P ++MVRFV+SGTEA M  +RLARAFT R++I +FEGCYHGH+D  L+KAGSG  TLG+
Sbjct:    1 MSRSEELFLQAQKHIPGGVNSPVRAFKAVGGTPVFFEKALGAYIWDADGKRYIDYVQSWGPMVLGHAHPEVINTVIDAAKHGLSFGAPTERETTLAEKLCSLMPGMDMVRFVSSGTEATMSAIRLARAFTKRDKIIKFEGCYHGHSDSLLIKAGSGALTLGV 162          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_SALAR (Glutamate-1-semialdehyde 2,1-aminomutase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=hemL PE=3 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.196e-49
Identity = 91/161 (56.52%), Postives = 118/161 (73.29%), Query Frame = 2
Query:  212 LKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLG 694
            +  SE  ++ A+EL+PGGVNSPVRAF  VGG P+  +   G+ ++D+DG  YIDYVGSWGP ++GH    +  A+ E  ++G SFGAP  +E  +AE+V S VP+++MVR VNSGTEA M  +RLAR FTGR++I +FEGCYHGHAD  LVKAGSG  TLG
Sbjct:    1 MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAWLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAELVTSLVPTMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLG 161          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_ROSS1 (Glutamate-1-semialdehyde 2,1-aminomutase OS=Roseiflexus sp. (strain RS-1) GN=hemL PE=3 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.196e-49
Identity = 96/159 (60.38%), Postives = 119/159 (74.84%), Query Frame = 2
Query:  221 SEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            SE  F  A+ L PGGVNSPVRAF++VGG P      +G+ ++D+DGN YIDYV SWGP I GH    V+AA+ E   +GTSFGAP  LE+ LA ++I A+P++EMVRFV+SGTEA M  LRLARA T R+++ +F GCYHGH D FLV+AGSGVATLGL
Sbjct:    6 SESLFAEAQSLFPGGVNSPVRAFRAVGGTPRFIARGEGALIFDVDGNRYIDYVLSWGPLIAGHTHPDVVAAIAEQAARGTSFGAPTELESELARLIIQAMPAVEMVRFVSSGTEAAMSALRLARAATRRDKVIKFAGCYHGHFDGFLVQAGSGVATLGL 164          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_MANSM (Glutamate-1-semialdehyde 2,1-aminomutase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=hemL PE=3 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.196e-49
Identity = 90/161 (55.90%), Postives = 119/161 (73.91%), Query Frame = 2
Query:  212 LKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLG 694
            + +S   F+ A++++PGGVNSPVRAFK VGG P+     KG+++WD D  +Y+DYVGSWGP I+GH    +L+A+ +T + G SFGAP  +E  LAE+V   +PS+EMVR V+SGTEA M  +RLAR +T R++I +FEGCYHGHAD  LVKAGSG  TLG
Sbjct:    1 MTDSNTLFSRAQQVIPGGVNSPVRAFKGVGGTPVFIQKAKGAYIWDTDDKQYVDYVGSWGPMILGHNHPAILSAVIKTAENGLSFGAPTPIEIDLAELVCKLIPSMEMVRMVSSGTEATMSAIRLARGYTNRDKIIKFEGCYHGHADSLLVKAGSGALTLG 161          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_FLAJ1 (Glutamate-1-semialdehyde 2,1-aminomutase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=hemL PE=3 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.561e-49
Identity = 90/160 (56.25%), Postives = 119/160 (74.38%), Query Frame = 2
Query:  215 KNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLG 694
            K S + F  A++++PGGVNSPVRAFK+VGG PI   S KG++++D DGN+ IDY+ SWGP ++GHA   V+ A+ E  K GTSFG P  LE  +A + +S VP+I+ +RFVNSGTEACM  +RLAR FT R++I +F GCYHGH+D FL++AGSG  T G
Sbjct:    4 KRSSQLFAEAEKVIPGGVNSPVRAFKAVGGTPIFVKSAKGAYLYDEDGNKLIDYINSWGPMVLGHAYQPVVDAVIEKAKLGTSFGMPTELETEIAALAVSMVPNIDKIRFVNSGTEACMSAIRLARGFTKRDKIIKFAGCYHGHSDSFLIQAGSGAVTFG 163          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_XANOR (Glutamate-1-semialdehyde 2,1-aminomutase OS=Xanthomonas oryzae pv. oryzae GN=hemL PE=3 SV=2)

HSP 1 Score: 195.667 bits (496), Expect = 2.039e-49
Identity = 94/159 (59.12%), Postives = 112/159 (70.44%), Query Frame = 2
Query:  221 SEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            S   F  A+ ++PGGVNSPVRAFKSVGG+P       GS+++D+DGN YIDYVGSWGP I GH    V  A+   ++ G SFGAPC  E  +AE +   VPS EMVR VNSGTEA +  +RLAR  TGR RI +FEGCYHGH D FLVKAGSG+ TLG+
Sbjct:    6 SHALFAQAQTVLPGGVNSPVRAFKSVGGEPFFVARADGSYLFDVDGNRYIDYVGSWGPMIAGHNHPAVREAVERAIRDGLSFGAPCAAEVTMAETITGLVPSCEMVRMVNSGTEATLSAVRLARGATGRNRIIKFEGCYHGHGDSFLVKAGSGMLTLGV 164          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_XANOP (Glutamate-1-semialdehyde 2,1-aminomutase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=hemL PE=3 SV=2)

HSP 1 Score: 195.667 bits (496), Expect = 2.039e-49
Identity = 94/159 (59.12%), Postives = 112/159 (70.44%), Query Frame = 2
Query:  221 SEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            S   F  A+ ++PGGVNSPVRAFKSVGG+P       GS+++D+DGN YIDYVGSWGP I GH    V  A+   ++ G SFGAPC  E  +AE +   VPS EMVR VNSGTEA +  +RLAR  TGR RI +FEGCYHGH D FLVKAGSG+ TLG+
Sbjct:    6 SHALFAQAQTVLPGGVNSPVRAFKSVGGEPFFVARADGSYLFDVDGNRYIDYVGSWGPMIAGHNHPAVREAVERAIRDGLSFGAPCAAEVTMAETITGLVPSCEMVRMVNSGTEATLSAVRLARGATGRNRIIKFEGCYHGHGDSFLVKAGSGMLTLGV 164          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_XANOM (Glutamate-1-semialdehyde 2,1-aminomutase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=hemL PE=3 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 2.039e-49
Identity = 94/159 (59.12%), Postives = 112/159 (70.44%), Query Frame = 2
Query:  221 SEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            S   F  A+ ++PGGVNSPVRAFKSVGG+P       GS+++D+DGN YIDYVGSWGP I GH    V  A+   ++ G SFGAPC  E  +AE +   VPS EMVR VNSGTEA +  +RLAR  TGR RI +FEGCYHGH D FLVKAGSG+ TLG+
Sbjct:    6 SHALFAQAQTVLPGGVNSPVRAFKSVGGEPFFVARADGSYLFDVDGNRYIDYVGSWGPMIAGHNHPAVREAVERAIRDGLSFGAPCAAEVTMAETITGLVPSCEMVRMVNSGTEATLSAVRLARGATGRNRIIKFEGCYHGHGDSFLVKAGSGMLTLGV 164          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_SHIBS (Glutamate-1-semialdehyde 2,1-aminomutase OS=Shigella boydii serotype 4 (strain Sb227) GN=hemL PE=3 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 2.039e-49
Identity = 89/161 (55.28%), Postives = 118/161 (73.29%), Query Frame = 2
Query:  212 LKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLG 694
            +  SE  ++ A+EL+PGGVNSPVRAF  VGG P+  +   G++++D+DG  YIDYVGSWGP ++GH    +  A+ E  ++G SFGAP  +E  +A++V   VP+++MVR VNSGTEA M  +RLAR FTGR++I +FEGCYHGHAD  LVKAGSG  TLG
Sbjct:    1 MSKSENLYSAARELLPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLG 161          
The following BLAST results are available for this feature:
BLAST of FC876179 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
GSA_CHLP89.154e-5058.64Glutamate-1-semialdehyde 2,1-aminomutase OS=Chloro... [more]
GSA_CELJU9.154e-5056.17Glutamate-1-semialdehyde 2,1-aminomutase OS=Cellvi... [more]
GSA_SALAR1.196e-4956.52Glutamate-1-semialdehyde 2,1-aminomutase OS=Salmon... [more]
GSA_ROSS11.196e-4960.38Glutamate-1-semialdehyde 2,1-aminomutase OS=Roseif... [more]
GSA_MANSM1.196e-4955.90Glutamate-1-semialdehyde 2,1-aminomutase OS=Mannhe... [more]
GSA_FLAJ11.561e-4956.25Glutamate-1-semialdehyde 2,1-aminomutase OS=Flavob... [more]
GSA_XANOR2.039e-4959.12Glutamate-1-semialdehyde 2,1-aminomutase OS=Xantho... [more]
GSA_XANOP2.039e-4959.12Glutamate-1-semialdehyde 2,1-aminomutase OS=Xantho... [more]
GSA_XANOM2.039e-4959.12Glutamate-1-semialdehyde 2,1-aminomutase OS=Xantho... [more]
GSA_SHIBS2.039e-4955.28Glutamate-1-semialdehyde 2,1-aminomutase OS=Shigel... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001C05EF DevOvary1 Citrus clementina cDNA clone C32001C05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876179 ID=FC876179; Name=FC876179; organism=Citrus clementina; type=EST; length=698bp
GACAGTTTCTTATCTTGATTGACCGAGGAAAAGAGAAAGAGACATCAGAG
AGAGTGACACAAAAATGGCAGCTACAATTACAGGGGTAGGAGTTGGGTTA
GGGCTTTCATGTTCATCAAAGCTCACCAAGAGATTTTCTTCTTCTACTGG
ATCCTCTCGCTGTAGTGTTAAAATGTCGGTCTCTGTTGAGGAGCAGAAGA
AAAATTTCACTTTAAAAAACTCTGAAGAAGCTTTCAATGTCGCCAAGGAA
TTGATGCCTGGAGGTGTAAATTCACCTGTACGTGCCTTCAAATCTGTTGG
TGGTCAACCTATTGTGTTTGATTCCGTCAAGGGCTCACACATGTGGGATA
TCGATGGCAACGAGTACATTGACTATGTAGGTTCTTGGGGGCCGGCAATT
ATTGGTCACGCAGATGATCAGGTACTAGCAGCCTTGGGTGAAACAATGAA
GAAAGGAACCAGCTTTGGTGCTCCTTGTCTTCTAGAGAATGTTCTTGCAG
AAATGGTAATCTCAGCTGTTCCAAGCATAGAAATGGTTCGTTTTGTTAAC
TCAGGCACAGAAGCATGCATGGGTGTGCTTCGCCTTGCCCGTGCCTTCAC
TGGGAGAGAGAGGATCATNCAATTTGAGGGTTGTTATCATGGCCATGCTG
ATCCATTTCTTGTCAAGGCTGGTAGTGGAGTTGCCACCCTAGGGCTTC
back to top