FC876179

Overview
NameFC876179
Unique NameFC876179
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length698
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10304 contig Ccv1_Contig10304:1..698. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_PROM9 (Glutamate-1-semialdehyde 2,1-aminomutase OS=Prochlorococcus marinus (strain MIT 9312) GN=hemL PE=3 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 1.774e-69
Identity = 125/159 (78.62%), Postives = 139/159 (87.42%), Query Frame = 2
Query:  221 SEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            SEE F+ A+ELMPGGV+SPVRAFKSVGGQPIVFD VKG   WDIDGN YIDY+GSWGPAI GHA  +V  AL E ++KGTSFGAPC+LEN LAEMVI AVPS+EMVRFVNSGTEACM VLRL RAFTGR+++ +F+GCYHGHAD FLVKAGSGVATLGL
Sbjct:   10 SEEIFSAAQELMPGGVSSPVRAFKSVGGQPIVFDRVKGPFAWDIDGNRYIDYIGSWGPAICGHAHPEVTTALQEAIEKGTSFGAPCVLENKLAEMVIDAVPSVEMVRFVNSGTEACMAVLRLMRAFTGRDKVIKFDGCYHGHADMFLVKAGSGVATLGL 168          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_SYNY3 (Glutamate-1-semialdehyde 2,1-aminomutase OS=Synechocystis sp. (strain PCC 6803) GN=hemL PE=3 SV=2)

HSP 1 Score: 261.922 bits (668), Expect = 2.317e-69
Identity = 126/164 (76.83%), Postives = 140/164 (85.37%), Query Frame = 2
Query:  206 FTLKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            F    SEE F  A+ LMPGGV+SPVRAFKSVGGQPIVFD V+G+ +WD+DGN+YIDYVG+WGPAI GHA   V++AL + + KGTSFGAPC  ENVLAEMVI AVPSIEMVRFVNSGTEACM VLRL RAFTGRE+I +FEGCYHGHAD FLVKAGSGVATLGL
Sbjct:    7 FITTKSEEIFAAAQHLMPGGVSSPVRAFKSVGGQPIVFDRVEGAQIWDVDGNQYIDYVGTWGPAICGHAHPDVISALKQALDKGTSFGAPCAQENVLAEMVIDAVPSIEMVRFVNSGTEACMSVLRLMRAFTGREKIIKFEGCYHGHADMFLVKAGSGVATLGL 170          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_PROMS (Glutamate-1-semialdehyde 2,1-aminomutase OS=Prochlorococcus marinus (strain AS9601) GN=hemL PE=3 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 3.026e-69
Identity = 126/165 (76.36%), Postives = 142/165 (86.06%), Query Frame = 2
Query:  203 NFTLKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            N+T   SEE F+ A++LMPGGV+SPVRAFKSVGGQPIVFD VKG   WDIDGN YIDY+GSWGPAI GHA  +V  AL E ++KGTSFGAPC+LEN LAEMVI AVPS+EMVRFVNSGTEACM VLRL RAFTGR+++ +F+GCYHGHAD FLVKAGSGVATLGL
Sbjct:    6 NYT--KSEEIFSAAQQLMPGGVSSPVRAFKSVGGQPIVFDRVKGPFAWDIDGNRYIDYIGSWGPAICGHAHPEVTTALQEAIEKGTSFGAPCVLENKLAEMVIDAVPSVEMVRFVNSGTEACMAVLRLMRAFTGRDKVIKFDGCYHGHADMFLVKAGSGVATLGL 168          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_PROM2 (Glutamate-1-semialdehyde 2,1-aminomutase OS=Prochlorococcus marinus (strain MIT 9215) GN=hemL PE=3 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 3.952e-69
Identity = 124/159 (77.99%), Postives = 139/159 (87.42%), Query Frame = 2
Query:  221 SEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            SEE F+ A++LMPGGV+SPVRAFKSVGGQPIVFD VKG   WDIDGN YIDY+GSWGPAI GHA  +V  AL E ++KGTSFGAPC+LEN LAEMVI AVPS+EMVRFVNSGTEACM VLRL RAFTGR+++ +F+GCYHGHAD FLVKAGSGVATLGL
Sbjct:   10 SEEIFSAAQQLMPGGVSSPVRAFKSVGGQPIVFDRVKGPFAWDIDGNRYIDYIGSWGPAICGHAHPEVTTALQEAIEKGTSFGAPCVLENKLAEMVIDAVPSVEMVRFVNSGTEACMAVLRLMRAFTGRDKVIKFDGCYHGHADMFLVKAGSGVATLGL 168          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_ANAVT (Glutamate-1-semialdehyde 2,1-aminomutase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hemL PE=3 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 3.952e-69
Identity = 127/167 (76.05%), Postives = 144/167 (86.23%), Query Frame = 2
Query:  203 NFTLKN--SEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            N T+K   S+E F  A+ LMPGGV+SPVRAFKSVGGQPIVFD VKG+++WD+DGN+YIDYVG+WGPAI GHA   V+ AL E ++KGTSFGAP  LENVLAEMVI+AVPSIEMVRFVNSGTEACM VLRL RAFT RE++ +FEGCYHGHAD FLVKAGSGVATLGL
Sbjct:    3 NTTIKTTKSQEIFAAAQNLMPGGVSSPVRAFKSVGGQPIVFDHVKGAYIWDVDGNQYIDYVGTWGPAICGHAHPDVIGALHEALEKGTSFGAPSFLENVLAEMVIAAVPSIEMVRFVNSGTEACMAVLRLMRAFTNREKVIKFEGCYHGHADMFLVKAGSGVATLGL 169          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_SYNPW (Glutamate-1-semialdehyde 2,1-aminomutase OS=Synechococcus sp. (strain WH7803) GN=hemL PE=3 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 5.162e-69
Identity = 121/159 (76.10%), Postives = 141/159 (88.68%), Query Frame = 2
Query:  221 SEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            S+E F+ A+ LMPGGV+SPVRAF+SVGGQP+VFD VKG + WD+DGN+YIDY+GSWGPAI GHA  +V++AL E ++KGTSFGAPC LEN LAEMVI AVPS+EMVRFVNSGTEACM VLRL RAFTGR+++ +FEGCYHGHAD FLVKAGSGVATLGL
Sbjct:   11 SQELFSAAQALMPGGVSSPVRAFRSVGGQPLVFDRVKGPYAWDVDGNKYIDYIGSWGPAICGHAHPEVISALQEAIEKGTSFGAPCALENTLAEMVIDAVPSVEMVRFVNSGTEACMAVLRLMRAFTGRDKVIKFEGCYHGHADMFLVKAGSGVATLGL 169          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_PROM5 (Glutamate-1-semialdehyde 2,1-aminomutase OS=Prochlorococcus marinus (strain MIT 9515) GN=hemL PE=3 SV=2)

HSP 1 Score: 260.766 bits (665), Expect = 5.162e-69
Identity = 123/164 (75.00%), Postives = 141/164 (85.98%), Query Frame = 2
Query:  206 FTLKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            F + +SEE F+ A +LMPGGV+SPVRAFKSVGGQPIVFD VKG   WD+DGN YIDY+GSWGPAI GHA  +V+ AL E ++KGTSFGAPC+ EN LAEMVI AVPS+EMVRFVNSGTEACM VLRL RAFTGR+++ +F+GCYHGHAD FLVKAGSGVATLGL
Sbjct:    5 FNITHSEEVFSSALKLMPGGVSSPVRAFKSVGGQPIVFDRVKGPFAWDVDGNRYIDYIGSWGPAICGHAHPEVITALQEAIEKGTSFGAPCVQENKLAEMVIDAVPSVEMVRFVNSGTEACMAVLRLMRAFTGRDKVIKFDGCYHGHADMFLVKAGSGVATLGL 168          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_SYNSC (Glutamate-1-semialdehyde 2,1-aminomutase OS=Synechococcus sp. (strain CC9605) GN=hemL PE=3 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 6.742e-69
Identity = 122/160 (76.25%), Postives = 140/160 (87.50%), Query Frame = 2
Query:  218 NSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            +S+  F  A+ LMPGGV+SPVRAFKSVGGQPIVFD VKG + WD+DGN+YIDY+GSWGPAI GHA  +V+AAL E ++KGTSFGAPC LEN LAEMVI AVPS+EMVRFVNSGTEACM VLRL RA+TGR+++ +FEGCYHGHAD FLVKAGSGVATLGL
Sbjct:    5 HSQAIFGAAQALMPGGVSSPVRAFKSVGGQPIVFDRVKGPYAWDVDGNKYIDYIGSWGPAICGHAHPEVIAALQEAIEKGTSFGAPCALENTLAEMVIDAVPSVEMVRFVNSGTEACMAVLRLIRAYTGRDKVIKFEGCYHGHADMFLVKAGSGVATLGL 164          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_MICAN (Glutamate-1-semialdehyde 2,1-aminomutase OS=Microcystis aeruginosa (strain NIES-843) GN=hemL PE=3 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 6.742e-69
Identity = 124/165 (75.15%), Postives = 145/165 (87.88%), Query Frame = 2
Query:  203 NFTLKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            ++    S+E F  A++LMPGGV+SPVRAFKSVGGQPIVF+SVKG+++ D+DGNEYIDYVG+WGPAI GHA  +V+AAL + + KGTSFGAPC+ EN+LAEMVI AVPSIEMVRFVNSGTEACM VLRL RAFTGR++I +FEGCYHGHAD FLVKAGSGVATLGL
Sbjct:    6 SYQTTKSKEIFTAAQKLMPGGVSSPVRAFKSVGGQPIVFESVKGAYIRDVDGNEYIDYVGTWGPAICGHAHPEVIAALHDALDKGTSFGAPCVQENILAEMVIDAVPSIEMVRFVNSGTEACMSVLRLMRAFTGRDKIIKFEGCYHGHADMFLVKAGSGVATLGL 170          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_TRIEI (Glutamate-1-semialdehyde 2,1-aminomutase OS=Trichodesmium erythraeum (strain IMS101) GN=hemL PE=3 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 8.805e-69
Identity = 122/159 (76.73%), Postives = 141/159 (88.68%), Query Frame = 2
Query:  221 SEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            SEE F  A++LMPGGV+SPVRAFKSVGGQPIVFD V+G+++WD+DGN+YIDYVG+WGPAI GHA  +VL  L E ++KGTSFGAPC LEN LA+MVI AVPSIEM+RFVNSGTEACM VLRL RAFTGR+++ +FEGCYHGHAD FLVKAGSGVATLGL
Sbjct:   11 SEEIFAAAQKLMPGGVSSPVRAFKSVGGQPIVFDRVQGAYIWDVDGNQYIDYVGTWGPAICGHAHPEVLNGLKEVLEKGTSFGAPCALENTLAKMVIDAVPSIEMIRFVNSGTEACMAVLRLMRAFTGRDKVIKFEGCYHGHADMFLVKAGSGVATLGL 169          
The following BLAST results are available for this feature:
BLAST of FC876179 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
GSA_PROM91.774e-6978.62Glutamate-1-semialdehyde 2,1-aminomutase OS=Prochl... [more]
GSA_SYNY32.317e-6976.83Glutamate-1-semialdehyde 2,1-aminomutase OS=Synech... [more]
GSA_PROMS3.026e-6976.36Glutamate-1-semialdehyde 2,1-aminomutase OS=Prochl... [more]
GSA_PROM23.952e-6977.99Glutamate-1-semialdehyde 2,1-aminomutase OS=Prochl... [more]
GSA_ANAVT3.952e-6976.05Glutamate-1-semialdehyde 2,1-aminomutase OS=Anabae... [more]
GSA_SYNPW5.162e-6976.10Glutamate-1-semialdehyde 2,1-aminomutase OS=Synech... [more]
GSA_PROM55.162e-6975.00Glutamate-1-semialdehyde 2,1-aminomutase OS=Prochl... [more]
GSA_SYNSC6.742e-6976.25Glutamate-1-semialdehyde 2,1-aminomutase OS=Synech... [more]
GSA_MICAN6.742e-6975.15Glutamate-1-semialdehyde 2,1-aminomutase OS=Microc... [more]
GSA_TRIEI8.805e-6976.73Glutamate-1-semialdehyde 2,1-aminomutase OS=Tricho... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001C05EF DevOvary1 Citrus clementina cDNA clone C32001C05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876179 ID=FC876179|Name=FC876179|organism=Citrus clementina|type=EST|length=698bp
GACAGTTTCTTATCTTGATTGACCGAGGAAAAGAGAAAGAGACATCAGAG
AGAGTGACACAAAAATGGCAGCTACAATTACAGGGGTAGGAGTTGGGTTA
GGGCTTTCATGTTCATCAAAGCTCACCAAGAGATTTTCTTCTTCTACTGG
ATCCTCTCGCTGTAGTGTTAAAATGTCGGTCTCTGTTGAGGAGCAGAAGA
AAAATTTCACTTTAAAAAACTCTGAAGAAGCTTTCAATGTCGCCAAGGAA
TTGATGCCTGGAGGTGTAAATTCACCTGTACGTGCCTTCAAATCTGTTGG
TGGTCAACCTATTGTGTTTGATTCCGTCAAGGGCTCACACATGTGGGATA
TCGATGGCAACGAGTACATTGACTATGTAGGTTCTTGGGGGCCGGCAATT
ATTGGTCACGCAGATGATCAGGTACTAGCAGCCTTGGGTGAAACAATGAA
GAAAGGAACCAGCTTTGGTGCTCCTTGTCTTCTAGAGAATGTTCTTGCAG
AAATGGTAATCTCAGCTGTTCCAAGCATAGAAATGGTTCGTTTTGTTAAC
TCAGGCACAGAAGCATGCATGGGTGTGCTTCGCCTTGCCCGTGCCTTCAC
TGGGAGAGAGAGGATCATNCAATTTGAGGGTTGTTATCATGGCCATGCTG
ATCCATTTCTTGTCAAGGCTGGTAGTGGAGTTGCCACCCTAGGGCTTC
back to top