FC876179

Overview
NameFC876179
Unique NameFC876179
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length698
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10304 contig Ccv1_Contig10304:1..698. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_STAHJ (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=hemL2 PE=3 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 4.690e-54
Identity = 104/161 (64.60%), Postives = 123/161 (76.40%), Query Frame = 2
Query:  215 KNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            + S EA  +A+ LMPGGVNSPVRAFKSV    I  D  KGS ++DIDGNEYIDYV SWGP I+GH ++QV+  L E + +GTSFGA  L EN LAE+VI  VPSIE VR V+SGTEA +  LRLAR +TGR +I +FEGCYHGH+D  L+KAGSGVATLGL
Sbjct:    4 EKSIEAMKIAENLMPGGVNSPVRAFKSVDTPAIFMDHAKGSRIYDIDGNEYIDYVLSWGPLILGHKNEQVIKKLHEAVNRGTSFGASTLEENKLAELVIERVPSIEKVRMVSSGTEATLAALRLARGYTGRNKIIKFEGCYHGHSDSLLIKAGSGVATLGL 164          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_BACC1 (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Bacillus cereus (strain ATCC 10987) GN=hemL2 PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 6.126e-54
Identity = 104/156 (66.67%), Postives = 123/156 (78.85%), Query Frame = 2
Query:  230 AFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            AF  A++LMPGGVNSPVRAFKSVG  P+  +  KGS ++DIDGNEYIDYV SWGP I GHA+++V+ AL    +KGTSFGAP  +EN LA++VI  VPSIE+VR VNSGTEA M  LRLAR +TGR +I +F GCYHGH D  L+KAGSGVATLGL
Sbjct:   10 AFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANNRVVEALKAVAEKGTSFGAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLGL 165          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_BACP2 (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Bacillus pumilus (strain SAFR-032) GN=hemL2 PE=3 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 8.001e-54
Identity = 101/161 (62.73%), Postives = 125/161 (77.64%), Query Frame = 2
Query:  215 KNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            + S++AF  A+ LMPGGVNSPVRAFKSV   PI  +  KG+ ++DIDGNEYIDYV SWGP I+GH +D+V+ ++    +KGTSFGA  L+EN LA++V   VPSIE++R V+SGTEA M  LRLAR FTGR +I +FEGCYHGH D  L+KAGSGVATLGL
Sbjct:    6 EKSKQAFEEAQHLMPGGVNSPVRAFKSVNTDPIFMERGKGAKIYDIDGNEYIDYVLSWGPLILGHTNDRVVESIQRVAEKGTSFGASTLVENELAKLVSERVPSIEVIRMVSSGTEATMSALRLARGFTGRNKIVKFEGCYHGHGDSLLIKAGSGVATLGL 166          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_BACSU (Glutamate-1-semialdehyde 2,1-aminomutase OS=Bacillus subtilis GN=hemL PE=1 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.365e-53
Identity = 102/161 (63.35%), Postives = 126/161 (78.26%), Query Frame = 2
Query:  215 KNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            + S+ AF  A++LMPGGVNSPVRAFKSV   PI  +  KGS ++DIDGNEYIDYV SWGP I+GH +D+V+ +L +  + GTSFGAP  +EN LA++VI  VPS+E+VR V+SGTEA M  LRLAR +TGR +I +FEGCYHGH D  L+KAGSGVATLGL
Sbjct:    5 EKSKTAFKEAQKLMPGGVNSPVRAFKSVDMDPIFMERGKGSKIFDIDGNEYIDYVLSWGPLILGHTNDRVVESLKKVAEYGTSFGAPTEVENELAKLVIDRVPSVEIVRMVSSGTEATMSALRLARGYTGRNKILKFEGCYHGHGDSLLIKAGSGVATLGL 165          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_OCEIH (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Oceanobacillus iheyensis GN=hemL2 PE=3 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.365e-53
Identity = 106/163 (65.03%), Postives = 123/163 (75.46%), Query Frame = 2
Query:  209 TLKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            TL  S +A+  A +LMPGGVNSPVRAFKSVG  PI     KGS + DID NEYIDYV SWGP I+GH+D++V+  L +   KGTSFGAP LLEN LA++VI  VPSIEMVR VNSGTEA M  +RLAR +T R+ I +FEG YHGH D  L+KAGSGVATLGL
Sbjct:    2 TLNQSIDAYKEAVDLMPGGVNSPVRAFKSVGMNPIFMKEGKGSKIVDIDNNEYIDYVLSWGPLILGHSDERVVKKLQDITAKGTSFGAPTLLENDLAKLVIDRVPSIEMVRMVNSGTEATMSAIRLARGYTDRDLILKFEGSYHGHGDSLLIKAGSGVATLGL 164          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_EXISA (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=hemL2 PE=3 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 2.328e-53
Identity = 103/159 (64.78%), Postives = 121/159 (76.10%), Query Frame = 2
Query:  221 SEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            S+EAF  A+ LMPGGVNSPVRA+KSVG  PI  +  +GS ++DIDGNEYIDYV SWGP I+GH D  V  A+ E  +KG +FG P  LE  +AE+VI  VPSIEMVR VNSGTEA M  LRLAR +TG+ +I +FEGCYHGH D  L+KAGSGVATLGL
Sbjct:    8 SQEAFEQARPLMPGGVNSPVRAYKSVGMTPIFAERGEGSRVYDIDGNEYIDYVLSWGPLILGHRDPVVTKAIQEQAEKGWTFGTPTELETKMAELVIDRVPSIEMVRMVNSGTEATMAALRLARGYTGKTKILKFEGCYHGHGDSLLIKAGSGVATLGL 166          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_ANOFW (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=hemL2 PE=3 SV=2)

HSP 1 Score: 208.764 bits (530), Expect = 2.328e-53
Identity = 102/161 (63.35%), Postives = 125/161 (77.64%), Query Frame = 2
Query:  215 KNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            + S+ A+  A +LMPGGVNSPVRAFK+V   PI     KGS ++DIDGNEYIDYV SWGP I+GHA+DQV+ AL    + GTSFGAP L+EN LA++V+  +PSIE++R V+SGTEA M  LRLAR +TGR +I +FEGCYHGH D  L+KAGSGVATLGL
Sbjct:    5 ERSKAAYAEAVKLMPGGVNSPVRAFKAVKMDPIFMARGKGSKIYDIDGNEYIDYVLSWGPLILGHANDQVVEALKRVAETGTSFGAPTLIENELAKLVMERMPSIEIIRMVSSGTEATMSALRLARGYTGRNKIVKFEGCYHGHGDSLLIKAGSGVATLGL 165          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_GEOTN (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=hemL2 PE=3 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 3.971e-53
Identity = 104/161 (64.60%), Postives = 123/161 (76.40%), Query Frame = 2
Query:  215 KNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            + S+ A+  A  LMPGGVNSPVRAFKSVG  PI     +G+ ++DIDGNEYIDYV SWGP I+GHAD QV+ AL    ++GTSFGAP LLEN LA++VI  VPS+E+VR VNSGTEA M  LRLAR +T R +I +FEG YHGH D  L+KAGSGVATLGL
Sbjct:    5 ERSKAAYEEAVTLMPGGVNSPVRAFKSVGMTPIFMARGQGAKIYDIDGNEYIDYVLSWGPLILGHADPQVVEALKRVAEQGTSFGAPTLLENELAKLVIERVPSVEIVRMVNSGTEATMSALRLARGYTKRNKIIKFEGSYHGHGDSLLIKAGSGVATLGL 165          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_STAS1 (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=hemL2 PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 6.773e-53
Identity = 104/160 (65.00%), Postives = 122/160 (76.25%), Query Frame = 2
Query:  218 NSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            NSE+A   A+ELMPGGVNSPVRAFKSV    I  D  +GS ++DIDGNEYIDYV SWGP I+GH + QV+  + E + KGTSFGA  L EN LAE+VI  VPSIE VR V+SGTEA +  LRLAR +TGR +I +F GCYHGH+D  L+KAGSGVATLGL
Sbjct:    5 NSEKAMAKAEELMPGGVNSPVRAFKSVDTPAIFMDHGEGSRIYDIDGNEYIDYVLSWGPLILGHKNKQVIEKIHEAVDKGTSFGASTLQENKLAELVIERVPSIEKVRMVSSGTEATLDTLRLARGYTGRNKIVKFVGCYHGHSDSLLIKAGSGVATLGL 164          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_BACLD (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Bacillus licheniformis (strain DSM 13 / ATCC 14580) GN=hemL2 PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 6.773e-53
Identity = 101/161 (62.73%), Postives = 124/161 (77.02%), Query Frame = 2
Query:  215 KNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            + S+ AF  A+ +MPGGVNSPVRAFKSV   PI  +  KGS ++DIDGNEYIDYV SWGP I+GH++++V+  + +  + GTSFGAP  LE  LAE+VI  VPSIE+VR V+SGTEA M  LRLAR +TGR +I +FEGCYHGH D  L+KAGSGVATLGL
Sbjct:    5 EKSKAAFEEAQRVMPGGVNSPVRAFKSVNMDPIFMERGKGSKIYDIDGNEYIDYVLSWGPLILGHSNEKVVKEIQKAAEHGTSFGAPTELETELAELVIDRVPSIEIVRMVSSGTEATMSALRLARGYTGRNKIVKFEGCYHGHGDSLLIKAGSGVATLGL 165          
The following BLAST results are available for this feature:
BLAST of FC876179 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
GSA2_STAHJ4.690e-5464.60Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Stap... [more]
GSA2_BACC16.126e-5466.67Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Baci... [more]
GSA2_BACP28.001e-5462.73Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Baci... [more]
GSA_BACSU1.365e-5363.35Glutamate-1-semialdehyde 2,1-aminomutase OS=Bacill... [more]
GSA2_OCEIH1.365e-5365.03Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Ocea... [more]
GSA2_EXISA2.328e-5364.78Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Exig... [more]
GSA2_ANOFW2.328e-5363.35Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Anox... [more]
GSA2_GEOTN3.971e-5364.60Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Geob... [more]
GSA2_STAS16.773e-5365.00Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Stap... [more]
GSA2_BACLD6.773e-5362.73Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Baci... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001C05EF DevOvary1 Citrus clementina cDNA clone C32001C05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876179 ID=FC876179|Name=FC876179|organism=Citrus clementina|type=EST|length=698bp
GACAGTTTCTTATCTTGATTGACCGAGGAAAAGAGAAAGAGACATCAGAG
AGAGTGACACAAAAATGGCAGCTACAATTACAGGGGTAGGAGTTGGGTTA
GGGCTTTCATGTTCATCAAAGCTCACCAAGAGATTTTCTTCTTCTACTGG
ATCCTCTCGCTGTAGTGTTAAAATGTCGGTCTCTGTTGAGGAGCAGAAGA
AAAATTTCACTTTAAAAAACTCTGAAGAAGCTTTCAATGTCGCCAAGGAA
TTGATGCCTGGAGGTGTAAATTCACCTGTACGTGCCTTCAAATCTGTTGG
TGGTCAACCTATTGTGTTTGATTCCGTCAAGGGCTCACACATGTGGGATA
TCGATGGCAACGAGTACATTGACTATGTAGGTTCTTGGGGGCCGGCAATT
ATTGGTCACGCAGATGATCAGGTACTAGCAGCCTTGGGTGAAACAATGAA
GAAAGGAACCAGCTTTGGTGCTCCTTGTCTTCTAGAGAATGTTCTTGCAG
AAATGGTAATCTCAGCTGTTCCAAGCATAGAAATGGTTCGTTTTGTTAAC
TCAGGCACAGAAGCATGCATGGGTGTGCTTCGCCTTGCCCGTGCCTTCAC
TGGGAGAGAGAGGATCATNCAATTTGAGGGTTGTTATCATGGCCATGCTG
ATCCATTTCTTGTCAAGGCTGGTAGTGGAGTTGCCACCCTAGGGCTTC
back to top