FC876179

Overview
NameFC876179
Unique NameFC876179
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length698
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10304 contig Ccv1_Contig10304:1..698. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_SYNAS (Glutamate-1-semialdehyde 2,1-aminomutase OS=Syntrophus aciditrophicus (strain SB) GN=hemL PE=3 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 8.846e-53
Identity = 97/159 (61.01%), Postives = 123/159 (77.36%), Query Frame = 2
Query:  221 SEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            SE+ F  A+ L+PGGVNSPVRAF++VGG P   D  +GS ++DIDG EYIDYVGSWGP I+GH+  QV+ A+ + +++GTS+GAP   E  LA  +I A PS+EM+R V+SGTEA M  +RLAR FTGR++I +FEGCYHGH D  LVKAGSGVATLG+
Sbjct:    6 SEQLFETAEGLLPGGVNSPVRAFRAVGGVPRFIDRAEGSRIYDIDGREYIDYVGSWGPMILGHSHPQVVEAIRKAVERGTSYGAPTPGEIALARTIIEAFPSMEMIRMVSSGTEAVMSAIRLARGFTGRDKILKFEGCYHGHGDSLLVKAGSGVATLGI 164          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_GEOUR (Glutamate-1-semialdehyde 2,1-aminomutase OS=Geobacter uraniireducens (strain Rf4) GN=hemL PE=3 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 8.846e-53
Identity = 99/159 (62.26%), Postives = 120/159 (75.47%), Query Frame = 2
Query:  221 SEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            SE  F  A++ +PGGVNSPVRAFKSVG  P+  +   GS ++D+DGNE+IDYVGSWGP I+GH   QV+AA+   +  G SFGAP  LE  LAEMVI AVPSIEMVR V+SGTEA M  +RLAR +TGR++I +F GCYHGH+D  LVKAGSG AT G+
Sbjct:    6 SELLFQEAQKAIPGGVNSPVRAFKSVGTDPLFIEKASGSRIYDVDGNEFIDYVGSWGPMILGHCHPQVVAAVKSAVDNGCSFGAPTELEITLAEMVIEAVPSIEMVRMVSSGTEATMSAIRLARGYTGRDKILKFSGCYHGHSDSLLVKAGSGAATFGV 164          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_CHLAD (Glutamate-1-semialdehyde 2,1-aminomutase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=hemL PE=3 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 8.846e-53
Identity = 99/159 (62.26%), Postives = 120/159 (75.47%), Query Frame = 2
Query:  221 SEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            S+  F  A+ ++PGGVNSPVRAF+ VGG PI F+  +G+H+WD+DGN YIDYV SWGP ++GHA   V+ A+    ++GTSFGAP  LE  LA +V+  VPSIE +RFVNSGTEA M  LRLARA TGR  I +F GCYHGHAD  LV+AGSGVATLGL
Sbjct:   11 SQANFAAAQAVIPGGVNSPVRAFRGVGGSPIFFERGQGAHIWDVDGNRYIDYVLSWGPLLLGHAHPAVVNAIATQAQRGTSFGAPTELETDLARLVLDLVPSIEQIRFVNSGTEATMSALRLARAATGRRLIVKFNGCYHGHADMLLVQAGSGVATLGL 169          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_GEOKA (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Geobacillus kaustophilus GN=hemL2 PE=3 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 8.846e-53
Identity = 103/161 (63.98%), Postives = 124/161 (77.02%), Query Frame = 2
Query:  215 KNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            + S+ A+  A +LMPGGVNSPVRAFKSVG  PI     +G+ ++DIDGNEYIDYV SWGP I+GHA+ QV+ AL    ++GTSFGAP LLEN LA++VI  VPS+E+VR VNSGTEA M  LRLAR +T R +I +FEG YHGH D  L+KAGSGVATLGL
Sbjct:    5 ERSKTAYEEAVKLMPGGVNSPVRAFKSVGMTPIFMARGQGAKIYDIDGNEYIDYVLSWGPLILGHANPQVVEALKRVAEQGTSFGAPTLLENELAKLVIERVPSVEIVRMVNSGTEATMSALRLARGYTKRNKIMKFEGSYHGHGDSLLIKAGSGVATLGL 165          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_PERMH (Glutamate-1-semialdehyde 2,1-aminomutase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=hemL PE=3 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 1.155e-52
Identity = 98/162 (60.49%), Postives = 122/162 (75.31%), Query Frame = 2
Query:  212 LKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            ++ S   F  A+  + GGVNSPVRAFKSVG +P+     KGS +WD+DGNEYIDYV SWGP I+GHA+DQ++ A+ +    GTSFGAP  LE  +A+ V+ AVPSIEMVRFVNSGTEA M  +RLAR +TG+++I +FEGCYHGH D  LV AGSGVATL +
Sbjct:    3 MERSLNLFEEAQRYLVGGVNSPVRAFKSVGMEPLFIQKGKGSRVWDVDGNEYIDYVLSWGPLILGHANDQIVNAIKQVANYGTSFGAPTELEIEMAKAVVDAVPSIEMVRFVNSGTEATMSAIRLARGYTGKKKIVKFEGCYHGHVDSLLVSAGSGVATLSI 164          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_HELMI (Glutamate-1-semialdehyde 2,1-aminomutase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=hemL PE=3 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 1.155e-52
Identity = 94/159 (59.12%), Postives = 124/159 (77.99%), Query Frame = 2
Query:  221 SEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            SE+ F  AK L+PGGVNSPVRAFKSVG  P+  +  +G++++D+DGN+Y+DYVGSWGP I+GHA  +V  AL   + +GTS+GAP  LE+ LA++++ A P+++MVR VNSGTEA M  LRLAR +TGR +I +FEGCYHGHAD  L+KAGSG  TLG+
Sbjct:    8 SEQLFAEAKTLIPGGVNSPVRAFKSVGRNPVFIERAEGAYLYDVDGNKYVDYVGSWGPMIVGHAHPEVSEALKAAIDRGTSYGAPTELESRLAKLILEAFPAMDMVRMVNSGTEATMSALRLARGYTGRSKIVKFEGCYHGHADSLLIKAGSGALTLGV 166          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_CHLT3 (Glutamate-1-semialdehyde 2,1-aminomutase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=hemL PE=3 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 1.155e-52
Identity = 101/162 (62.35%), Postives = 121/162 (74.69%), Query Frame = 2
Query:  212 LKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKK-GTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLG 694
            LK S   F  AK+++PGGVNSPVRAF SVGG P+     +G+ M D+DGN YIDYVGSWGP I+GH+  +V+ A+  TMK  GTSFGAP  LE  LAE++I  VPS+EMVR VNSGTEA M  +RLAR +T RE+I +FEGCYHGH D FL+KAGSG  TLG
Sbjct:    4 LKTSAALFERAKKVIPGGVNSPVRAFNSVGGTPVFVTKGEGARMIDVDGNSYIDYVGSWGPFILGHSHPRVIEAIERTMKAHGTSFGAPTELEIELAELIIKVVPSVEMVRMVNSGTEATMSAIRLARGYTKREKIIKFEGCYHGHGDSFLIKAGSGALTLG 165          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_BACA2 (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Bacillus amyloliquefaciens (strain FZB42) GN=hemL2 PE=3 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 1.155e-52
Identity = 101/161 (62.73%), Postives = 124/161 (77.02%), Query Frame = 2
Query:  215 KNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            + S+ AF  A++LMPGGVNSPVRAFKSV   PI     KGS ++DIDGNEYIDYV SWGP I+GH +D+V+ +L +  + GTSFGA   +EN LA++VI  VPS+E+VR V+SGTEA M  LRLAR +TGR +I +FEGCYHGH D  L+KAGSGVATLGL
Sbjct:    5 EKSKAAFKEAQKLMPGGVNSPVRAFKSVDMDPIFMQRGKGSKIFDIDGNEYIDYVLSWGPLILGHTNDRVVESLKKVAENGTSFGASTEVENELAKLVIDRVPSVEIVRMVSSGTEATMSALRLARGYTGRNKILKFEGCYHGHGDSLLIKAGSGVATLGL 165          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_BREBN (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=hemL2 PE=3 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 1.509e-52
Identity = 98/161 (60.87%), Postives = 121/161 (75.16%), Query Frame = 2
Query:  215 KNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            + S + F  A+  +PGGVNSPVRAFKSVGG P+  +  +GS ++D+DGN YIDY+GSWGP I+GHA  +VLAA+ E    GTSFGAP   E  +A++V   VPS+E+VR VNSGTEA M  LRLAR +T R +I +FEGCYHGHAD  L+KAGSGVATLGL
Sbjct:    4 EKSTQLFAEAQHYIPGGVNSPVRAFKSVGGNPVYIEKGEGSRIFDVDGNSYIDYIGSWGPLILGHAHPRVLAAITEVAALGTSFGAPTERETEMAKLVCEIVPSVEVVRMVNSGTEATMSALRLARGYTRRNKIMKFEGCYHGHADSLLIKAGSGVATLGL 164          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA1_STAES (Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=hemL1 PE=3 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 1.509e-52
Identity = 103/163 (63.19%), Postives = 124/163 (76.07%), Query Frame = 2
Query:  209 TLKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            + + S +A   A++LMPGGVNSPVRAFKSV    I  D  +GS ++DIDGNEYIDYV SWGP I+GH + QV++ L E + KGTSFGA  L EN LAE+VI  VPSIE VR V+SGTEA +  LRLAR +TGR +I +FEGCYHGH+D  L+KAGSGVATLGL
Sbjct:    2 SFEKSIKAMEQAEKLMPGGVNSPVRAFKSVDTPAIFMDHGEGSKIYDIDGNEYIDYVLSWGPLILGHKNQQVISKLHEAVDKGTSFGASTLQENKLAELVIDRVPSIEKVRMVSSGTEATLDTLRLARGYTGRNKIIKFEGCYHGHSDSLLIKAGSGVATLGL 164          
The following BLAST results are available for this feature:
BLAST of FC876179 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
GSA_SYNAS8.846e-5361.01Glutamate-1-semialdehyde 2,1-aminomutase OS=Syntro... [more]
GSA_GEOUR8.846e-5362.26Glutamate-1-semialdehyde 2,1-aminomutase OS=Geobac... [more]
GSA_CHLAD8.846e-5362.26Glutamate-1-semialdehyde 2,1-aminomutase OS=Chloro... [more]
GSA2_GEOKA8.846e-5363.98Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Geob... [more]
GSA_PERMH1.155e-5260.49Glutamate-1-semialdehyde 2,1-aminomutase OS=Persep... [more]
GSA_HELMI1.155e-5259.12Glutamate-1-semialdehyde 2,1-aminomutase OS=Heliob... [more]
GSA_CHLT31.155e-5262.35Glutamate-1-semialdehyde 2,1-aminomutase OS=Chloro... [more]
GSA2_BACA21.155e-5262.73Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Baci... [more]
GSA2_BREBN1.509e-5260.87Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Brev... [more]
GSA1_STAES1.509e-5263.19Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Stap... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001C05EF DevOvary1 Citrus clementina cDNA clone C32001C05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876179 ID=FC876179|Name=FC876179|organism=Citrus clementina|type=EST|length=698bp
GACAGTTTCTTATCTTGATTGACCGAGGAAAAGAGAAAGAGACATCAGAG
AGAGTGACACAAAAATGGCAGCTACAATTACAGGGGTAGGAGTTGGGTTA
GGGCTTTCATGTTCATCAAAGCTCACCAAGAGATTTTCTTCTTCTACTGG
ATCCTCTCGCTGTAGTGTTAAAATGTCGGTCTCTGTTGAGGAGCAGAAGA
AAAATTTCACTTTAAAAAACTCTGAAGAAGCTTTCAATGTCGCCAAGGAA
TTGATGCCTGGAGGTGTAAATTCACCTGTACGTGCCTTCAAATCTGTTGG
TGGTCAACCTATTGTGTTTGATTCCGTCAAGGGCTCACACATGTGGGATA
TCGATGGCAACGAGTACATTGACTATGTAGGTTCTTGGGGGCCGGCAATT
ATTGGTCACGCAGATGATCAGGTACTAGCAGCCTTGGGTGAAACAATGAA
GAAAGGAACCAGCTTTGGTGCTCCTTGTCTTCTAGAGAATGTTCTTGCAG
AAATGGTAATCTCAGCTGTTCCAAGCATAGAAATGGTTCGTTTTGTTAAC
TCAGGCACAGAAGCATGCATGGGTGTGCTTCGCCTTGCCCGTGCCTTCAC
TGGGAGAGAGAGGATCATNCAATTTGAGGGTTGTTATCATGGCCATGCTG
ATCCATTTCTTGTCAAGGCTGGTAGTGGAGTTGCCACCCTAGGGCTTC
back to top