FC876214

Overview
NameFC876214
Unique NameFC876214
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ACTP7 (60 kDa chaperonin OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=groL PE=3 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 9.063e-64
Identity = 122/216 (56.48%), Postives = 162/216 (75.00%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++K+ G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A+ AV+ +LK+ ++   T +EI QV TISAN +  +G+L+A+AMEKVGKEGVITV DG  + + L+ V GM+  RGY+SPYF+  P+    ELENP
Sbjct:    3 AKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVVLDKAYGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVVAVVEELKAISKPCETSKEIEQVGTISANSDETVGKLIAQAMEKVGKEGVITVEDGTGLDDALDVVEGMQFDRGYLSPYFINKPEAGTVELENP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ACTP2 (60 kDa chaperonin OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=groL PE=3 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 9.063e-64
Identity = 122/216 (56.48%), Postives = 162/216 (75.00%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++K+ G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A+ AV+ +LK+ ++   T +EI QV TISAN +  +G+L+A+AMEKVGKEGVITV DG  + + L+ V GM+  RGY+SPYF+  P+    ELENP
Sbjct:    3 AKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVVLDKAYGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVVAVVEELKAISKPCETSKEIEQVGTISANSDETVGKLIAQAMEKVGKEGVITVEDGTGLDDALDVVEGMQFDRGYLSPYFINKPEAGTVELENP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH601_RHORT (60 kDa chaperonin 1 OS=Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255) GN=groL1 PE=3 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 9.063e-64
Identity = 119/216 (55.09%), Postives = 165/216 (76.39%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ F   AR  +L+GV  +A AVKVT+GPKGRNV+I+KS G P++TKDGV+VA  IE +DK +++GA ++++VA  +   AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A+ AV+ D+K+R++ I+T +EI QV TISANG+ E+G+++ARAM+KVG EGVITV +   +  EL+ V GM+  RGY+SPYFVT+ +    +LENP
Sbjct:    3 AKDVKFSSDARDRLLRGVDTLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELKDKFENMGAQMLREVASKSADVAGDGTTTATVLAQAIVREGSKAVAAGMNPMDLKRGIDLAVAAVVKDVKTRSRKIATNDEIAQVGTISANGDEEVGKIIARAMDKVGHEGVITVEEAKGLDTELDVVEGMQFDRGYLSPYFVTNAEKMVADLENP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH601_RHIL3 (60 kDa chaperonin 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=groL1 PE=3 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 9.063e-64
Identity = 123/215 (57.21%), Postives = 164/215 (76.28%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            +K+I FG  AR  ML+GV  +A+AVKVT+GPKGRNVII+KS G P++TKDGV+VA  IE  DK +++GA +V++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A+  V+ DL+++A+ IST EE+ QV TISANG++++G  +A AM+KVG EGVITV +  T   ELE V GM+  RGY+SPYFVT+P+    +LE+
Sbjct:    3 SKEIKFGRTAREKMLRGVDILADAVKVTLGPKGRNVIIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGNKAVAAGMNPMDLKRGIDLAVADVVKDLQAKAKKISTSEEVAQVGTISANGDKQVGLDIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMIADLED 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_METPP (60 kDa chaperonin OS=Methylibium petroleiphilum (strain PM1) GN=groL PE=3 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 1.184e-63
Identity = 120/216 (55.56%), Postives = 165/216 (76.39%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  ARA M++GV+ +A AVKVT+GPKGRNV++E+S G P VTKDGV+VA  IE +DK +++GA +VK+VA  T+  AGDGTT ATVL QAI+ EG K VAAG+N MDL+ GI  A+ +++  LK +++  +T +EI QV TISAN + ++G+++A AM+KVGKEGVITV DG ++ NEL+ V GM+  RGY+SPYF+ +P+ Q   L+NP
Sbjct:    3 AKDVVFGGEARARMVEGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEIELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQAIVREGMKYVAAGMNPMDLKRGIDKAVVSLVEQLKKQSKPTTTSKEIAQVGTISANSDDDVGQIIASAMDKVGKEGVITVEDGKSLNNELDVVEGMQFDRGYLSPYFINNPEKQSAVLDNP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_LEPCP (60 kDa chaperonin OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=groL PE=3 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 1.184e-63
Identity = 121/216 (56.02%), Postives = 164/216 (75.93%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  ARA M++GV+ +A AVKVT+GPKGRNV++E+S G P VTKDGV+VA  IE +DK +++GA +VK+VA  T+  AGDGTT ATVL QAI+ EG K VAAG+N MDL+ GI  A+ A++++LK  ++  +T +EI QV +ISAN +  IG ++A AM+KVGKEGVITV DG ++ NEL+ V GM+  RGY+SPYF+ +P+ Q   L+NP
Sbjct:    3 AKDVIFGGEARARMVEGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEIELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQAIVREGMKYVAAGMNPMDLKRGIDKAVHALVAELKKASKATTTSKEIAQVGSISANSDESIGTIIANAMDKVGKEGVITVEDGKSLDNELDVVEGMQFDRGYLSPYFINNPEKQAALLDNP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ERWAP (60 kDa chaperonin (Fragment) OS=Erwinia aphidicola GN=groL PE=3 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 1.184e-63
Identity = 122/216 (56.48%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL Q+I+TEG K+VAAG+N MDL+ GI  A+ A + +LK  +   S  + I QV TISAN +  +GEL+A+AMEKVGKEGVITV +G  + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGLKAVAAGMNPMDLKRGIDQAVIAAVDELKKLSVPCSDSKAIAQVGTISANSDATVGELIAQAMEKVGKEGVITVEEGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ENTAM (60 kDa chaperonin (Fragment) OS=Enterobacter amnigenus GN=groL PE=3 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 1.184e-63
Identity = 122/216 (56.48%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+TEG K+VAAG+N MDL+ GI  A+ A + +LK+ +   S  + I QV TISAN +  +G+L+A AM+KVGKEGVITV DG  + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVIAAVEELKTLSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLEDELDVVEGMQFDRGYLSPYFINKPETGAVELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ENT38 (60 kDa chaperonin OS=Enterobacter sp. (strain 638) GN=groL PE=3 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 1.184e-63
Identity = 122/216 (56.48%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+TEG K+VAAG+N MDL+ GI  A+ A + +LK+ +   S  + I QV TISAN +  +G+L+A AM+KVGKEGVITV DG  + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPAITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVIAAVEELKTLSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLEDELDVVEGMQFDRGYLSPYFINKPETGAVELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_CAUCR (60 kDa chaperonin OS=Caulobacter crescentus GN=groL PE=3 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 1.184e-63
Identity = 121/217 (55.76%), Postives = 161/217 (74.19%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            AKD+ F   AR  ML+GV+ +A AVKVT+GPKGRNV+IEKS G P+ TKDGV+VA  IE  DK +++GA ++++VA  TN  AGDGTT ATVL QAI+ EG KSVAAG+N MDL+ GI  A+   I D+K+ ++ ++T  EI QV TISANG++E+GE++A+AM+KVG EGVITV +  T   EL+ V GM+  RGY+SPYF+T+    + +LE PL
Sbjct:    3 AKDVYFSSDARDKMLRGVNILANAVKVTLGPKGRNVVIEKSFGAPRTTKDGVSVAKEIELADKFENLGAQMIREVASKTNDKAGDGTTTATVLAQAIVQEGLKSVAAGMNPMDLKRGIDKAVAIAIEDIKTSSKKVTTNAEIAQVGTISANGDKEVGEMIAKAMDKVGNEGVITVEEAKTAETELDVVEGMQFDRGYLSPYFITNADKMEVQLEEPL 219          
The following BLAST results are available for this feature:
BLAST of FC876214 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_ACTP79.063e-6456.4860 kDa chaperonin OS=Actinobacillus pleuropneumoni... [more]
CH60_ACTP29.063e-6456.4860 kDa chaperonin OS=Actinobacillus pleuropneumoni... [more]
CH601_RHORT9.063e-6455.0960 kDa chaperonin 1 OS=Rhodospirillum rubrum (stra... [more]
CH601_RHIL39.063e-6457.2160 kDa chaperonin 1 OS=Rhizobium leguminosarum bv.... [more]
CH60_METPP1.184e-6355.5660 kDa chaperonin OS=Methylibium petroleiphilum (s... [more]
CH60_LEPCP1.184e-6356.0260 kDa chaperonin OS=Leptothrix cholodnii (strain ... [more]
CH60_ERWAP1.184e-6356.4860 kDa chaperonin (Fragment) OS=Erwinia aphidicola... [more]
CH60_ENTAM1.184e-6356.4860 kDa chaperonin (Fragment) OS=Enterobacter amnig... [more]
CH60_ENT381.184e-6356.4860 kDa chaperonin OS=Enterobacter sp. (strain 638)... [more]
CH60_CAUCR1.184e-6355.7660 kDa chaperonin OS=Caulobacter crescentus GN=gro... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G09EF DevOvary1 Citrus clementina cDNA clone C32001G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876214 ID=FC876214|Name=FC876214|organism=Citrus clementina|type=EST|length=725bp
GAGCCTCTTCAATCAGTTCCCCTCGCTGCAAGAAAGGGGTGTATGGTAGG
GTTTTATGCAATAGGAACTATGTGGCGAAGGATATCAATTTTGGAGTTGG
TGCACGAGCTGCCATGTTACAAGGTGTATCCGAGGTGGCAGAAGCTGTAA
AAGTTACCATGGGACCAAAGGGTCGCAATGTGATTATTGAGAAAAGTGTT
GGAAATCCCAAGGTCACAAAGGATGGTGTTACTGTTGCCAGCAGCATAGA
ATTCAGGGACAAGGCAAAAGATGTTGGTGCAAACCTTGTAAAGCAGGTTG
CCGGTGCTACTAATAAAGCTGCGGGAGATGGTACAACTTGCGCAACTGTT
CTGACTCAGGCCATTCTCACAGAAGGCTGTAAATCTGTAGCTGCTGGTCT
AAATGTGATGGATTTGCGCAGTGGTATTAAGATGGCGATCGATGCAGTCA
TATCTGATTTAAAAAGCAGAGCACAAATGATTAGTACACCGGAAGAAATT
ACACAGGTGGCGACTATCTCTGCAAATGGTGAACGGGAGATTGGGGAACT
GCTAGCAAGAGCAATGGAGAAAGTTGGAAAGGAAGGAGTCATTACTGTTG
TTGATGGAAATACTATGGTTAATGAGCTGGAAAGTGTTGGAGGAATGAAG
CTAGCCAGAGGTTACATTTCTCCTTATTTTGTTACAGATCCAAAGACACA
GAAATGTGAACTTGAAAATCCTCTG
back to top