FC876217

Overview
NameFC876217
Unique NameFC876217
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:50..689. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_GEOSL (Adenosylhomocysteinase OS=Geobacter sulfurreducens GN=ahcY PE=3 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 5.069e-41
Identity = 80/143 (55.94%), Postives = 103/143 (72.03%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            ++ + D+S A +GR E+ +AE EMPGLMA R E+  ++P +GA+I GSLHMTIQTA+LIETL ALGAEVRW SCNIFSTQDH              +KGE+L+EYW  T +  +W  GG P++I+DDGGDATLL+H G  AE+
Sbjct:   15 DYCISDISLAAWGRKEMIIAETEMPGLMAIREEYAATRPLQGARIAGSLHMTIQTAMLIETLVALGAEVRWASCNIFSTQDHAAAAIAAAGIPVFAYKGESLEEYWEFTHRIFEWHDGGTPNMILDDGGDATLLLHLGSDAEK 157          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_XANC5 (Adenosylhomocysteinase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=ahcY PE=3 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 6.620e-41
Identity = 84/155 (54.19%), Postives = 106/155 (68.39%), Query Frame = 2
Query:   89 SVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW----GPGGGPDLIVDDGGDATLLIHEGVKAE 541
            +V K     ++K+ D+S AD+GR E+++AE EMPGLM+ R +   ++P K  +ITGSLHMTIQTAVLIETL  +GA+VRW SCNIFSTQDH              WKGETL+EYW CT  AL +    G   GP+L+VDDGGD TLLIH+G + E
Sbjct:    3 AVTKITPHTDYKIADISLADWGRKELDIAEHEMPGLMSIRRKHAQTKPLKDVRITGSLHMTIQTAVLIETLKDIGADVRWASCNIFSTQDHAAAAIAATGTPVFAWKGETLEEYWDCTLDALTFTLPDGTLTGPELVVDDGGDVTLLIHKGYELE 157          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_XANAC (Adenosylhomocysteinase OS=Xanthomonas axonopodis pv. citri GN=ahcY PE=3 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 6.620e-41
Identity = 84/155 (54.19%), Postives = 106/155 (68.39%), Query Frame = 2
Query:   89 SVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW----GPGGGPDLIVDDGGDATLLIHEGVKAE 541
            +V K     ++K+ D+S AD+GR E+++AE EMPGLM+ R +   ++P K  +ITGSLHMTIQTAVLIETL  +GA+VRW SCNIFSTQDH              WKGETL+EYW CT  AL +    G   GP+L+VDDGGD TLLIH+G + E
Sbjct:    3 AVTKITPHTDYKIADISLADWGRKELDIAEHEMPGLMSIRRKHAQTKPLKDVRITGSLHMTIQTAVLIETLKDIGADVRWASCNIFSTQDHAAAAIAATGTPVFAWKGETLEEYWDCTLDALTFTLPDGTLTGPELVVDDGGDVTLLIHKGYELE 157          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_RHOBA (Adenosylhomocysteinase OS=Rhodopirellula baltica GN=ahcY PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.129e-40
Identity = 87/172 (50.58%), Postives = 108/172 (62.79%), Query Frame = 2
Query:  119 FKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHE------------------GVKAEEIYEKTGKLPDPA 580
            +KVKD+S AD+GR EIELAE EMPGLMA R+++G  +P KGA+I G LHMTIQTAVLIETL  LGAEV W SCNIFSTQDH              WKG T +E+ WC E+ LD+  G   ++I+DDGGD T ++H+                  GV   E+  K+GKL  P+
Sbjct:   11 YKVKDISLADYGRKEIELAENEMPGLMALRSKYGAEKPLKGARIAGCLHMTIQTAVLIETLVELGAEVTWSSCNIFSTQDHAAAAIAAAGIPVYAWKGMTEEEFDWCIEQTLDFPSGEKLNMILDDGGDLTAMVHDRFPELLDNIYGISEETTAGVHRLEVLNKSGKLRVPS 182          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_MARMM (Adenosylhomocysteinase OS=Maricaulis maris (strain MCS10) GN=ahcY PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.129e-40
Identity = 82/146 (56.16%), Postives = 102/146 (69.86%), Query Frame = 2
Query:  104 ASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            A+ + + VKD+S A +GR+E ++AE+EMPGLMA R E+  SQP KGA+I GSLHMT+QTA+LIETLTALGAEVRW SCNIFSTQDH               KGETL+EYW   +    W  G   ++I+DDGGDAT+ +  G KAE
Sbjct:    5 AADKPYIVKDMSLAKWGRIEFDMAEIEMPGLMALREEYKDSQPLKGARIAGSLHMTVQTAILIETLTALGAEVRWASCNIFSTQDHAAAAIAETGVPVFATKGETLEEYWDYADAIFHWPDGETANMILDDGGDATMYLILGEKAE 150          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_SPHAL (Adenosylhomocysteinase OS=Sphingopyxis alaskensis GN=ahcY PE=3 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.475e-40
Identity = 91/174 (52.30%), Postives = 109/174 (62.64%), Query Frame = 2
Query:  101 SASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW---GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVL 613
            +A  R++ V D+  ADFGR EI +AE EMPGLMA RAE+G SQP KGA+ITGSLHMTIQTAVLIETLTALGAEVRW +CNIFSTQ+H               KGE+L +YW    +  DW     G   +LI+DDGGDAT+    G K     E    +P P + +  E Q  L
Sbjct:    5 AADTRDYVVADIGLADFGRKEINIAETEMPGLMALRAEYGASQPLKGARITGSLHMTIQTAVLIETLTALGAEVRWATCNIFSTQNHAAAAIAASGVPVFAVKGESLADYWDYVGRIFDWESDNDGRTANLILDDGGDATMFALWGAK----LEAGETMPPPENEEEVEMQRAL 174          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PROM4 (Adenosylhomocysteinase OS=Prochlorococcus marinus (strain MIT 9211) GN=ahcY PE=3 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.475e-40
Identity = 84/156 (53.85%), Postives = 106/156 (67.95%), Query Frame = 2
Query:   77 AMALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            A + S Q+  +  E+++ D+  A+FGR E+ +AE EMPGLMA R ++   +P KGA+I GSLHMTIQTAVLIETL ALGA+VRW SCNIFSTQDH               KGETL EYW  T + L+WG    P++I+DDGGDAT L+  G KAE+
Sbjct:    3 AASASTQQLHNHIEYEIADIELAEFGRKELAIAEKEMPGLMALREKYHKEKPLKGARIAGSLHMTIQTAVLIETLVALGAQVRWASCNIFSTQDHAAAAIASSGIPVFAKKGETLDEYWAYTHRILEWGDQETPNMILDDGGDATGLVILGSKAEQ 158          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_XANOP (Adenosylhomocysteinase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=ahcY PE=3 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.926e-40
Identity = 84/155 (54.19%), Postives = 104/155 (67.10%), Query Frame = 2
Query:   89 SVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW----GPGGGPDLIVDDGGDATLLIHEGVKAE 541
            +V K     ++K+ D+S AD+GR E+++AE EMPGLM+ R +   + P K  +ITGSLHMTIQTAVLIETL  +GA VRW SCNIFSTQDH              WKGETL+EYW CT  AL +    G   GP+L+VDDGGD TLLIH+G + E
Sbjct:    3 AVTKITPHADYKIADISLADWGRKELDIAEHEMPGLMSIRRKHAQTTPLKDVRITGSLHMTIQTAVLIETLKDIGANVRWASCNIFSTQDHAAAAIAATGTPVFAWKGETLEEYWDCTLDALTFTLPDGTLTGPELVVDDGGDVTLLIHKGYELE 157          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_XANOM (Adenosylhomocysteinase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ahcY PE=3 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.926e-40
Identity = 84/155 (54.19%), Postives = 104/155 (67.10%), Query Frame = 2
Query:   89 SVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW----GPGGGPDLIVDDGGDATLLIHEGVKAE 541
            +V K     ++K+ D+S AD+GR E+++AE EMPGLM+ R +   + P K  +ITGSLHMTIQTAVLIETL  +GA VRW SCNIFSTQDH              WKGETL+EYW CT  AL +    G   GP+L+VDDGGD TLLIH+G + E
Sbjct:    3 AVTKITPHADYKIADISLADWGRKELDIAEHEMPGLMSIRRKHAQTTPLKDVRITGSLHMTIQTAVLIETLKDIGANVRWASCNIFSTQDHAAAAIAATGTPVFAWKGETLEEYWDCTLDALTFTLPDGTLTGPELVVDDGGDVTLLIHKGYELE 157          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_RHOSH (Adenosylhomocysteinase OS=Rhodobacter sphaeroides GN=ahcY PE=3 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 2.516e-40
Identity = 85/142 (59.86%), Postives = 101/142 (71.13%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            +F VKDLS ADFGR E+++AE EMPGLMA R EFG S+P KGA+I GSLHMT+QTAVLIETL ALGA+VRW SCNIFSTQDH               KGETL++YW  T+K   +   G  ++I+DDGGDATL I  G + E
Sbjct:    3 DFIVKDLSLADFGRKELDIAETEMPGLMALREEFGASKPLKGARIAGSLHMTVQTAVLIETLVALGADVRWASCNIFSTQDHAAAAIAASGVPVFAIKGETLEDYWAYTDKIFQFA-DGTCNMILDDGGDATLYILLGARVE 143          
The following BLAST results are available for this feature:
BLAST of FC876217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_GEOSL5.069e-4155.94Adenosylhomocysteinase OS=Geobacter sulfurreducens... [more]
SAHH_XANC56.620e-4154.19Adenosylhomocysteinase OS=Xanthomonas campestris p... [more]
SAHH_XANAC6.620e-4154.19Adenosylhomocysteinase OS=Xanthomonas axonopodis p... [more]
SAHH_RHOBA1.129e-4050.58Adenosylhomocysteinase OS=Rhodopirellula baltica G... [more]
SAHH_MARMM1.129e-4056.16Adenosylhomocysteinase OS=Maricaulis maris (strain... [more]
SAHH_SPHAL1.475e-4052.30Adenosylhomocysteinase OS=Sphingopyxis alaskensis ... [more]
SAHH_PROM41.475e-4053.85Adenosylhomocysteinase OS=Prochlorococcus marinus ... [more]
SAHH_XANOP1.926e-4054.19Adenosylhomocysteinase OS=Xanthomonas oryzae pv. o... [more]
SAHH_XANOM1.926e-4054.19Adenosylhomocysteinase OS=Xanthomonas oryzae pv. o... [more]
SAHH_RHOSH2.516e-4059.86Adenosylhomocysteinase OS=Rhodobacter sphaeroides ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H01EF DevOvary1 Citrus clementina cDNA clone C32001H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876217 ID=FC876217|Name=FC876217|organism=Citrus clementina|type=EST|length=640bp
GTGGTCGGGTTCACAAAGAGAGAGTATAGTGACCTCTCTTCCTTCTTCCT
TTTAGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAA
TCCGCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTT
CGGCCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGG
CTTGCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATC
ACCGGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCT
CACCGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAA
CCCAAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTT
GCCTGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGC
CCTGGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTG
GTGACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTAC
GAGAAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACTACGCCGAGTT
TCAGATTGTTTTGACTATCATTAGAGATGGGTTGAAGGCC
back to top