FC876217

Overview
NameFC876217
Unique NameFC876217
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:50..689. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_ACIAD (Adenosylhomocysteinase OS=Acinetobacter sp. (strain ADP1) GN=ahcY PE=3 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.292e-36
Identity = 77/143 (53.85%), Postives = 95/143 (66.43%), Query Frame = 2
Query:  101 SASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW-GPGGGPDLIVDDGGDATLLIHE 526
            +AS  ++KV D+S AD+GR EI+LAE EMP L+  R  +   +P  GAKI G +HMTIQTAVLIETL  LGAEVRW SCNIFSTQDH              WKGET +EY WC E+ ++  G     ++I+DDGGD T L+HE
Sbjct:   12 NASFTDYKVADISLADYGRKEIKLAEAEMPALIGLRKRYAAEKPLAGAKILGCIHMTIQTAVLIETLVELGAEVRWTSCNIFSTQDHAAAAIAASGVPVFAWKGETEEEYNWCLEQQINVNGKPWDANMILDDGGDLTALVHE 154          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_COXBU (Adenosylhomocysteinase OS=Coxiella burnetii GN=ahcY PE=3 SV=2)

HSP 1 Score: 151.754 bits (382), Expect = 2.878e-36
Identity = 73/144 (50.69%), Postives = 96/144 (66.67%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDAT 511
            M   ++ +   +++ + +++ AD+GR EIE+AE EMPGLMA R ++  ++P KGA+I G +HMTIQTAVLIETL  LGAEVRW SCNIFSTQDH              WKGET +EYW C    L+   G  P+L++DDGGD T
Sbjct:    1 MENDMETATMTQDYHIANINLADWGRKEIEIAETEMPGLMALRKKYKNAKPLKGARIAGCIHMTIQTAVLIETLMLLGAEVRWSSCNIFSTQDHAAAALAQKGIPIFAWKGETEEEYWRCIASTLEGPKGWTPNLLLDDGGDLT 144          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_COXBN (Adenosylhomocysteinase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=ahcY PE=3 SV=2)

HSP 1 Score: 151.754 bits (382), Expect = 2.878e-36
Identity = 73/144 (50.69%), Postives = 96/144 (66.67%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDAT 511
            M   ++ +   +++ + +++ AD+GR EIE+AE EMPGLMA R ++  ++P KGA+I G +HMTIQTAVLIETL  LGAEVRW SCNIFSTQDH              WKGET +EYW C    L+   G  P+L++DDGGD T
Sbjct:    1 MENDMETATMTQDYHIANINLADWGRKEIEIAETEMPGLMALRKKYKNAKPLKGARIAGCIHMTIQTAVLIETLMLLGAEVRWSSCNIFSTQDHAAAALAQKGIPIFAWKGETEEEYWRCIASTLEGPKGWTPNLLLDDGGDLT 144          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_COXB2 (Adenosylhomocysteinase OS=Coxiella burnetii (strain CbuG_Q212) GN=ahcY PE=3 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 2.878e-36
Identity = 73/144 (50.69%), Postives = 96/144 (66.67%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDAT 511
            M   ++ +   +++ + +++ AD+GR EIE+AE EMPGLMA R ++  ++P KGA+I G +HMTIQTAVLIETL  LGAEVRW SCNIFSTQDH              WKGET +EYW C    L+   G  P+L++DDGGD T
Sbjct:    1 MENDMETATMTQDYHIANINLADWGRKEIEIAETEMPGLMALRKKYKNAKPLKGARIAGCIHMTIQTAVLIETLMLLGAEVRWSSCNIFSTQDHAAAALAQKGIPIFAWKGETEEEYWRCIASTLEGPKGWTPNLLLDDGGDLT 144          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_COXB1 (Adenosylhomocysteinase OS=Coxiella burnetii (strain CbuK_Q154) GN=ahcY PE=3 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 2.878e-36
Identity = 73/144 (50.69%), Postives = 96/144 (66.67%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDAT 511
            M   ++ +   +++ + +++ AD+GR EIE+AE EMPGLMA R ++  ++P KGA+I G +HMTIQTAVLIETL  LGAEVRW SCNIFSTQDH              WKGET +EYW C    L+   G  P+L++DDGGD T
Sbjct:    1 MENDMETATMTQDYHIANINLADWGRKEIEIAETEMPGLMALRKKYKNAKPLKGARIAGCIHMTIQTAVLIETLMLLGAEVRWSSCNIFSTQDHAAAALAQKGIPIFAWKGETEEEYWRCIASTLEGPKGWTPNLLLDDGGDLT 144          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PSEE4 (Adenosylhomocysteinase OS=Pseudomonas entomophila (strain L48) GN=ahcY PE=3 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 6.412e-36
Identity = 78/147 (53.06%), Postives = 95/147 (64.63%), Query Frame = 2
Query:   89 SVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKA-LDWGPGGGPDLIVDDGGDATLLIHE 526
            +V   A   +FKV D+S AD+GR E+ +AE EMP LM  R ++   QP KGAKI G +HMTIQTAVLIETL ALGAEVRW SCNIFSTQD               WKGET QEY WC E+  L  G     ++++DDGGD T ++H+
Sbjct:    3 AVNTPAGFSDFKVADISLADWGRKEVIIAESEMPALMGLRRKYQAEQPLKGAKIIGCIHMTIQTAVLIETLVALGAEVRWSSCNIFSTQDQAAAAIAAAGIPVFAWKGETEQEYEWCIEQTILKDGQPWDANMVLDDGGDLTEILHK 149          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PSEMY (Adenosylhomocysteinase OS=Pseudomonas mendocina (strain ymp) GN=ahcY PE=3 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 8.374e-36
Identity = 80/167 (47.90%), Postives = 105/167 (62.87%), Query Frame = 2
Query:   89 SVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKA-LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPAST 586
            +V   A   ++KV D+S AD+GR E+ +AE EMP LM  R ++  SQP KGAKI G +HMTIQT VLIETLTALGAEVRW SCNIFSTQD               WKGET +EY WC E+  L  G     ++++DDGGD T ++H+  K  ++ E+   + +  +T
Sbjct:    3 AVLTPAGFTDYKVADISLADWGRKELIIAESEMPALMGLRRKYAASQPLKGAKILGCIHMTIQTGVLIETLTALGAEVRWSSCNIFSTQDQAAAAIAAAGIPVFAWKGETEEEYEWCIEQTILKDGKPWDANMVLDDGGDLTEILHK--KYPQMLERIHGITEETTT 167          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_FLAJ1 (Adenosylhomocysteinase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=ahcY PE=3 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 8.374e-36
Identity = 88/173 (50.87%), Postives = 104/173 (60.12%), Query Frame = 2
Query:  119 FKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGP-DLIVDDGGDATLLIHE-------GVK---------AEEIYE--KTGKLPDPA 580
            FKVKD+S A +GR EIELAE EMPGLMA RAE+   QP KGA+I G LHMTIQTAVLIETL ALGAEV W SCNIFSTQD               WKG   + + WC E+ L +G    P ++I+DDGGD T ++ +       G+K            +YE  K G LP PA
Sbjct:   11 FKVKDISLAAWGRKEIELAEAEMPGLMALRAEYKDEQPLKGARIAGCLHMTIQTAVLIETLIALGAEVTWSSCNIFSTQDQAAAAIAAAGISVYAWKGLDEESFDWCIEQTLFFGEERKPLNMILDDGGDLTNMVIDRYPELVAGIKGLSEETTTGVHRLYERVKAGTLPMPA 183          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PSEU5 (Adenosylhomocysteinase OS=Pseudomonas stutzeri (strain A1501) GN=ahcY PE=3 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.428e-35
Identity = 80/167 (47.90%), Postives = 103/167 (61.68%), Query Frame = 2
Query:   89 SVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKA-LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPAST 586
            +V   A   +FKV D+S A +GR EI +AE EMP LM  R ++   QP KGAKI G +HMTIQTAVLIETL ALGAEVRW SCNIFSTQD               WKGET +EY WC E+  L  G     ++++DDGGD T ++H+  K  ++ E+   + +  +T
Sbjct:    3 AVMTPAGFTDFKVADISLAAWGRREIIIAESEMPALMGLRRKYAAEQPLKGAKILGCIHMTIQTAVLIETLIALGAEVRWSSCNIFSTQDQAAAAIAAAGIPVFAWKGETEEEYEWCIEQTILKDGQPWDANMVLDDGGDLTQILHD--KYPQVLERVHGITEETTT 167          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_FLAPJ (Adenosylhomocysteinase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=ahcY PE=3 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.866e-35
Identity = 88/173 (50.87%), Postives = 103/173 (59.54%), Query Frame = 2
Query:  119 FKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGP-DLIVDDGGDATLLI-------HEGVK---------AEEIYE--KTGKLPDPA 580
            FKVKD+S A +GR EIELAE EMPGLMA RAE+   QP  GA+I G LHMTIQTAVLIETL ALGAEV W SCNIFSTQD               WKG    ++ WC E+ L +G    P ++I+DDGGD T ++        EG+K            +YE  K G LP PA
Sbjct:   11 FKVKDISLAAWGRKEIELAEAEMPGLMALRAEYKNEQPLAGARIAGCLHMTIQTAVLIETLIALGAEVTWSSCNIFSTQDQAAAAIAAAGIQVYAWKGLNEPDFDWCIEQTLFFGEDRKPLNMILDDGGDLTNMVIDRYPHLVEGIKGLSEETTTGVHRLYERVKAGTLPMPA 183          
The following BLAST results are available for this feature:
BLAST of FC876217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_ACIAD1.292e-3653.85Adenosylhomocysteinase OS=Acinetobacter sp. (strai... [more]
SAHH_COXBU2.878e-3650.69Adenosylhomocysteinase OS=Coxiella burnetii GN=ahc... [more]
SAHH_COXBN2.878e-3650.69Adenosylhomocysteinase OS=Coxiella burnetii (strai... [more]
SAHH_COXB22.878e-3650.69Adenosylhomocysteinase OS=Coxiella burnetii (strai... [more]
SAHH_COXB12.878e-3650.69Adenosylhomocysteinase OS=Coxiella burnetii (strai... [more]
SAHH_PSEE46.412e-3653.06Adenosylhomocysteinase OS=Pseudomonas entomophila ... [more]
SAHH_PSEMY8.374e-3647.90Adenosylhomocysteinase OS=Pseudomonas mendocina (s... [more]
SAHH_FLAJ18.374e-3650.87Adenosylhomocysteinase OS=Flavobacterium johnsonia... [more]
SAHH_PSEU51.428e-3547.90Adenosylhomocysteinase OS=Pseudomonas stutzeri (st... [more]
SAHH_FLAPJ1.866e-3550.87Adenosylhomocysteinase OS=Flavobacterium psychroph... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H01EF DevOvary1 Citrus clementina cDNA clone C32001H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876217 ID=FC876217|Name=FC876217|organism=Citrus clementina|type=EST|length=640bp
GTGGTCGGGTTCACAAAGAGAGAGTATAGTGACCTCTCTTCCTTCTTCCT
TTTAGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAA
TCCGCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTT
CGGCCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGG
CTTGCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATC
ACCGGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCT
CACCGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAA
CCCAAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTT
GCCTGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGC
CCTGGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTG
GTGACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTAC
GAGAAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACTACGCCGAGTT
TCAGATTGTTTTGACTATCATTAGAGATGGGTTGAAGGCC
back to top