FC876217

Overview
NameFC876217
Unique NameFC876217
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:50..689. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_METMP (Adenosylhomocysteinase OS=Methanococcus maripaludis GN=ahcY PE=3 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 3.535e-18
Identity = 53/133 (39.85%), Postives = 70/133 (52.63%), Query Frame = 2
Query:  125 VKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIH 523
            VKD+S A  G L++E A+  MP L     EF   +PF+G  I  +LH+  +TA+L ETL   GA++    CN  STQD               W+GET +EY+    K LD      PD+I+DDG D   LIH
Sbjct:    4 VKDMSLAPSGHLKMEWAKRHMPVLCRIAEEFKNDKPFEGLTIGMALHLEAKTAILAETLLEGGAKIVITGCNPLSTQDDVAAACVEKGMEVYAWRGETNEEYYENLNKVLD----SNPDIIIDDGADLIFLIH 132          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_SULSO (Adenosylhomocysteinase OS=Sulfolobus solfataricus GN=ahcY PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.754e-17
Identity = 56/148 (37.84%), Postives = 75/148 (50.68%), Query Frame = 2
Query:  119 FKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE-EIYEKT 559
            +K+KDLS A  G+ +IE AE  MP LM  R  F   +P KG  I+  LH+T +TA L++TL   GA V     N  STQD               WKGE   EY+   E  +       P++++DDG D    IHE V ++ +IY  T
Sbjct:    3 YKIKDLSLASEGKKQIEWAERHMPTLMEIRKRFKAEKPLKGINISAVLHVTKETAALVKTLKIGGANVALAGSNPLSTQDDVAAALVEEGISVFAWKGENETEYYSNIESIVKIHE---PNIVMDDGADLHAYIHEKVSSKLDIYGGT 147          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PYRHO (Adenosylhomocysteinase OS=Pyrococcus horikoshii GN=ahcY PE=3 SV=2)

HSP 1 Score: 89.3521 bits (220), Expect = 1.754e-17
Identity = 54/139 (38.85%), Postives = 76/139 (54.68%), Query Frame = 2
Query:  110 GREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHE 526
            GR++ VKDLS AD G  +I+     MP L   R EF   +PFKG +I  +LH+ ++TA L+ TL A GAEV   + N  STQD                +GE+ ++Y+    KALD      P++I+DDG D   L+H+
Sbjct:    4 GRDYCVKDLSLADEGWKKIDWVSRFMPVLQHIRREFEEKKPFKGVRIAATLHLEMKTAFLLLTLKAGGAEVSAAASNPLSTQDDVVAALAKAGVKVYAIRGESKEQYYEFMHKALDI----RPNIIIDDGADMISLVHK 138          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_METJA (Adenosylhomocysteinase OS=Methanocaldococcus jannaschii GN=ahcY PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 3.908e-17
Identity = 50/135 (37.04%), Postives = 71/135 (52.59%), Query Frame = 2
Query:  119 FKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIH 523
            ++V+D++    G  +I+ A+  MP L   R  F   +PFKG  I  +LH+  +TAVL ETL   GAE+    CN  STQD               W+GET++EY+    K LD      PD+++DDG D   L+H
Sbjct:    2 YEVRDINLWKEGERKIQWAKQHMPVLNLIRERFKEEKPFKGITIGMALHLEAKTAVLAETLMEGGAEIAITGCNPLSTQDDVAAACAKKGMHVYAWRGETVEEYYENLNKVLD----HKPDIVIDDGCDLIFLLH 132          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_METKA (Adenosylhomocysteinase OS=Methanopyrus kandleri GN=ahcY PE=3 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 6.666e-17
Identity = 52/136 (38.24%), Postives = 70/136 (51.47%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIH 523
            E+ ++D S A  GR  IE A   MP L A R  F   +P +G  +  +LH+  +TAVL+ETL A GAEV    CN  ST+D               W+GET +EY+   ++ L       PD+IVDDG D    +H
Sbjct:    8 EYAIRDPSLAPKGRDMIEWARDHMPVLGAIRERFEEERPLEGITVGMTLHLEAKTAVLVETLMAGGAEVAITGCNPLSTKDEVAAALVEEGVHVYAWRGETEEEYYQNIDRVL----SHEPDIIVDDGADCIARVH 139          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PYRFU (Adenosylhomocysteinase OS=Pyrococcus furiosus GN=ahcY PE=3 SV=2)

HSP 1 Score: 85.5001 bits (210), Expect = 2.533e-16
Identity = 51/139 (36.69%), Postives = 76/139 (54.68%), Query Frame = 2
Query:  110 GREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHE 526
            G+++ VKDLS A+ G  +I+     MP L   + EF   +PFKG +I  +LH+ ++TA L+ TL A GAEV   + N  STQD                +GE+ ++Y+    KALD      P++I+DDG D   L+H+
Sbjct:    4 GKDYCVKDLSLAEEGWKKIDWVSRFMPVLQYIKREFEEKKPFKGVRIAATLHLEMKTAFLLLTLKAGGAEVSAAASNPLSTQDDVVAALAKAGVKVYAIRGESREQYYEFMHKALDI----RPNIIIDDGADMISLVHK 138          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_METTH (Adenosylhomocysteinase OS=Methanobacterium thermoautotrophicum GN=ahcY PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.308e-16
Identity = 49/135 (36.30%), Postives = 68/135 (50.37%), Query Frame = 2
Query:  119 FKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIH 523
            +KVKD+S A  G  +I   +  MP L   +++F   +PFKG  I   LH+  +T  L  TL A GAEV    CN  STQD               W+GET +EY+    + LD      P++++DDG D   L+H
Sbjct:    3 YKVKDISLAPQGEKKIRWVQEHMPVLERIKSDFSEEKPFKGVTIGSCLHLEPKTINLGLTLQAGGAEVAMTGCNPLSTQDDATAAGAKMGLNMYGWRGETNEEYYENIHRVLD----HEPEILIDDGADMIFLVH 133          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PYRAE (Adenosylhomocysteinase OS=Pyrobaculum aerophilum GN=ahcY PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.642e-15
Identity = 56/157 (35.67%), Postives = 76/157 (48.41%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHE---GVK---AEEIYEKTGKL 568
            E +VKD S AD GR ++  AE+ MP L+  R  F   +P  G  I   LH+T +T VL+ TL A GAEV     N  STQD               W+G + +EY+     A+ +     P + +DDG D T  IH+   GV+    E + E  G L
Sbjct:    3 ESRVKDSSLADRGREQLYWAELNMPVLLEIRRRFEKEKPLSGHVIAACLHVTKETGVLVRTLAAGGAEVVLIPSNPLSTQDDVAAALAQEGIHVYAWRGMSEREYY----NAIGFALSFNPTITMDDGADLTATIHKIGHGVRDQTIEYVLETAGSL 155          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PYRAB (Adenosylhomocysteinase OS=Pyrococcus abyssi GN=ahcY PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.801e-15
Identity = 50/136 (36.76%), Postives = 72/136 (52.94%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIH 523
            ++ VKD+S A  G  +I+     MP L   R EF   +PFKG +I  +LH+ ++TA L+ TL A GA+V   + N  STQD                +GE+ +EY+    KALD      P++I+DDG D   L+H
Sbjct:    7 DYCVKDISLAPEGMKKIDWVSRFMPVLQHIRREFEEKKPFKGVRIAATLHLEMKTAFLLLTLKAGGAKVSAAASNPLSTQDDVVAALAKEGVKVYAIRGESKEEYYEFMNKALDI----RPNIIIDDGADMVSLVH 138          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PYRKO (Adenosylhomocysteinase OS=Pyrococcus kodakaraensis GN=ahcY PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.044e-14
Identity = 47/131 (35.88%), Postives = 69/131 (52.67%), Query Frame = 2
Query:  113 REFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGD 505
            +++ VKD+S A  G  +I+     MP L   R +F   +PFKG +I  +LH+ ++TA L+ TL A GAEV   + N  STQD                +GE  ++Y+    KALD      P++I+DDG D
Sbjct:    5 KDYCVKDISLAPSGEKKIDWVSRFMPVLQHIRKDFEERKPFKGVRIAATLHLEMKTAFLLLTLKAAGAEVSAAASNPLSTQDDVVAALAKAGVKVYAIRGEDREQYYEFMHKALD----VKPNIIIDDGAD 131          
The following BLAST results are available for this feature:
BLAST of FC876217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_METMP3.535e-1839.85Adenosylhomocysteinase OS=Methanococcus maripaludi... [more]
SAHH_SULSO1.754e-1737.84Adenosylhomocysteinase OS=Sulfolobus solfataricus ... [more]
SAHH_PYRHO1.754e-1738.85Adenosylhomocysteinase OS=Pyrococcus horikoshii GN... [more]
SAHH_METJA3.908e-1737.04Adenosylhomocysteinase OS=Methanocaldococcus janna... [more]
SAHH_METKA6.666e-1738.24Adenosylhomocysteinase OS=Methanopyrus kandleri GN... [more]
SAHH_PYRFU2.533e-1636.69Adenosylhomocysteinase OS=Pyrococcus furiosus GN=a... [more]
SAHH_METTH3.308e-1636.30Adenosylhomocysteinase OS=Methanobacterium thermoa... [more]
SAHH_PYRAE1.642e-1535.67Adenosylhomocysteinase OS=Pyrobaculum aerophilum G... [more]
SAHH_PYRAB2.801e-1536.76Adenosylhomocysteinase OS=Pyrococcus abyssi GN=ahc... [more]
SAHH_PYRKO4.044e-1435.88Adenosylhomocysteinase OS=Pyrococcus kodakaraensis... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H01EF DevOvary1 Citrus clementina cDNA clone C32001H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876217 ID=FC876217|Name=FC876217|organism=Citrus clementina|type=EST|length=640bp
GTGGTCGGGTTCACAAAGAGAGAGTATAGTGACCTCTCTTCCTTCTTCCT
TTTAGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAA
TCCGCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTT
CGGCCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGG
CTTGCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATC
ACCGGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCT
CACCGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAA
CCCAAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTT
GCCTGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGC
CCTGGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTG
GTGACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTAC
GAGAAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACTACGCCGAGTT
TCAGATTGTTTTGACTATCATTAGAGATGGGTTGAAGGCC
back to top