FC876217

Overview
NameFC876217
Unique NameFC876217
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:50..689. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_LEPBJ (Adenosylhomocysteinase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=ahcY PE=3 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 1.861e-43
Identity = 88/147 (59.86%), Postives = 102/147 (69.39%), Query Frame = 2
Query:   86 LSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHE 526
            +S      G  +KVKDLSQA++GR EI LAE EMPGLMA R E+   +P  GA+I GSLHMTIQTAVLIETLT LGAEVRW SCNIFSTQDH              WKGET +EYWWC E+ L +G   GP++I+DDGGD T  +HE
Sbjct:    1 MSATTQEKGLNYKVKDLSQAEWGRQEIILAEKEMPGLMALRQEYKGKKPLAGARIAGSLHMTIQTAVLIETLTELGAEVRWSSCNIFSTQDHAAAAIAKAGVPVFAWKGETEEEYWWCIEQTLFFG-DKGPNMILDDGGDLTAYVHE 146          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_SYNS3 (Adenosylhomocysteinase OS=Synechococcus sp. (strain CC9311) GN=ahcY PE=3 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 2.431e-43
Identity = 86/156 (55.13%), Postives = 107/156 (68.59%), Query Frame = 2
Query:   77 AMALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            A A +  +    +++ + D+  ADFGR E+ +AE EMPGLMA RA++G  +P KGA+I GSLHMTIQTAVLIETL  LGA+VRW SCNIFSTQDH               KGETL+EYW  T   L+WG GG P++I+DDGGDAT L+  G KAE+
Sbjct:    3 ATAAATAELQVAKDYVIADIGLADFGRKELNIAETEMPGLMALRAKYGKDKPLKGARIAGSLHMTIQTAVLIETLVELGADVRWASCNIFSTQDHAAAAMAAGGIPVFAVKGETLEEYWDYTHSILEWGDGGTPNMILDDGGDATGLVMLGSKAEQ 158          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_RALME (Adenosylhomocysteinase OS=Ralstonia metallidurans (strain CH34 / ATCC 43123 / DSM 2839) GN=ahcY PE=3 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 2.431e-43
Identity = 85/144 (59.03%), Postives = 104/144 (72.22%), Query Frame = 2
Query:  113 REFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            +++ V D+  A +GR EI +AE EMPGLMA R EF  +QP KGA+I GSLHMTIQTAVLIETL ALGA+VRW SCNIFSTQDH              +KGE+L+EYW  T +  DW  GG P++I+DDGGDATLL+H G +AE+
Sbjct:    9 QDYIVADIGLAGWGRKEIAIAETEMPGLMAIRDEFAAAQPLKGARIAGSLHMTIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAIAASGTPVFAFKGESLKEYWDFTHRIFDWADGGTPNMILDDGGDATLLLHLGARAEK 152          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_COREF (Adenosylhomocysteinase OS=Corynebacterium efficiens GN=ahcY PE=3 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 2.431e-43
Identity = 93/181 (51.38%), Postives = 113/181 (62.43%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH--------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIRDGL 634
            +FKV DLS A+ GR +I LAE EMPGLM  R E+   QP KGA+I GS+HMT+QTAVLIETLTALGAEVRW SCNIFSTQD                       WKGETL EYWWC  +   W  G  P++I+DDGGDAT+ +  G +    YEK G +P P + D  E+   L ++R+ L
Sbjct:    6 DFKVADLSLAEAGRHQIRLAEYEMPGLMQLRREYAEEQPLKGARIAGSIHMTVQTAVLIETLTALGAEVRWASCNIFSTQDEAAAAIVVGDGTPEDPQGVPVFAWKGETLDEYWWCINQIFSW-EGELPNMILDDGGDATMAVIRGRE----YEKAGVVPQPEANDSDEYIAFLGMLREVL 181          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_XYLFT (Adenosylhomocysteinase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=ahcY PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 5.416e-43
Identity = 86/152 (56.58%), Postives = 108/152 (71.05%), Query Frame = 2
Query:   98 KSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW----GPGGGPDLIVDDGGDATLLIHEGVKAE 541
            +++    +K+ D+S AD+GR EI++AE EMPGLM+ R ++   QP KG ++TGSLHMTIQTAVLIETL  +GA+VRW SCNIFSTQDH              WKGETL+EYW CT +AL +    G   GP+LIVDDGGDATLLIH+G + E
Sbjct:    6 QTSPNTHYKIADISLADWGRKEIDIAEHEMPGLMSIRRKYASKQPLKGVRVTGSLHMTIQTAVLIETLKDIGADVRWASCNIFSTQDHAAAAIATSGTPVFAWKGETLEEYWDCTLQALTFTLADGTLTGPELIVDDGGDATLLIHKGYELE 157          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_XYLF2 (Adenosylhomocysteinase OS=Xylella fastidiosa (strain M23) GN=ahcY PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 5.416e-43
Identity = 86/152 (56.58%), Postives = 108/152 (71.05%), Query Frame = 2
Query:   98 KSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW----GPGGGPDLIVDDGGDATLLIHEGVKAE 541
            +++    +K+ D+S AD+GR EI++AE EMPGLM+ R ++   QP KG ++TGSLHMTIQTAVLIETL  +GA+VRW SCNIFSTQDH              WKGETL+EYW CT +AL +    G   GP+LIVDDGGDATLLIH+G + E
Sbjct:    6 QTSPNTHYKIADISLADWGRKEIDIAEHEMPGLMSIRRKYASKQPLKGVRVTGSLHMTIQTAVLIETLKDIGADVRWASCNIFSTQDHAAAAIATSGTPVFAWKGETLEEYWDCTLQALTFTLADGTLTGPELIVDDGGDATLLIHKGYELE 157          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_SYNSC (Adenosylhomocysteinase OS=Synechococcus sp. (strain CC9605) GN=ahcY PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 5.416e-43
Identity = 85/145 (58.62%), Postives = 103/145 (71.03%), Query Frame = 2
Query:  110 GREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            G +  + D++ ADFGR E+++AE EMPGLMA R ++G  +P KGA+I GSLHMTIQTAVLIETL  LGAEVRW SCNIFSTQDH               KGETL+EYW  T   L+WG GG P++I+DDGGDAT L+  G KAE+
Sbjct:   14 GVDCVIADINLADFGRKELDIAETEMPGLMALREKYGSEKPLKGARIAGSLHMTIQTAVLIETLVELGAEVRWASCNIFSTQDHAAAAIAAKGIPVFAVKGETLEEYWDYTHSILEWGDGGSPNMILDDGGDATGLVMLGSKAEQ 158          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_LEPIN (Adenosylhomocysteinase OS=Leptospira interrogans GN=ahcY PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 5.416e-43
Identity = 88/147 (59.86%), Postives = 102/147 (69.39%), Query Frame = 2
Query:   86 LSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHE 526
            +SV        +KVKDLSQA++GR EI LAE EMPGLMA R E+   +P  GA+I GSLHMTIQTAVLIETLT LGAEVRW SCNIFSTQDH              WKGET +EYWWC E+ + +G   GP++I+DDGGD T  IHE
Sbjct:    1 MSVTTQEKDLSYKVKDLSQAEWGRQEIILAEKEMPGLMALRQEYKGKKPLAGARIAGSLHMTIQTAVLIETLTELGAEVRWSSCNIFSTQDHAAAAIAKAGIPVFAWKGETEEEYWWCIEQTIFFG-DKGPNMILDDGGDLTAYIHE 146          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_LEPIC (Adenosylhomocysteinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni GN=ahcY PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 5.416e-43
Identity = 88/147 (59.86%), Postives = 102/147 (69.39%), Query Frame = 2
Query:   86 LSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHE 526
            +SV        +KVKDLSQA++GR EI LAE EMPGLMA R E+   +P  GA+I GSLHMTIQTAVLIETLT LGAEVRW SCNIFSTQDH              WKGET +EYWWC E+ + +G   GP++I+DDGGD T  IHE
Sbjct:    1 MSVTTQEKDLSYKVKDLSQAEWGRQEIILAEKEMPGLMALRQEYKGKKPLAGARIAGSLHMTIQTAVLIETLTELGAEVRWSSCNIFSTQDHAAAAIAKAGIPVFAWKGETEEEYWWCIEQTIFFG-DKGPNMILDDGGDLTAYIHE 146          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BRUSU (Adenosylhomocysteinase OS=Brucella suis GN=ahcY PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 5.416e-43
Identity = 86/145 (59.31%), Postives = 104/145 (71.72%), Query Frame = 2
Query:  107 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            + ++F VKD+S AD+GR E+++AE EMPGLMA R EFG SQP KGA+I+GSLHMTIQTAVLIETL  LGAEVRW SCNIFSTQDH               KGETL+EYW  T++   W  G   ++I+DDGGDAT+ I  G +AE
Sbjct:    3 ASQDFVVKDISLADWGRKELDIAETEMPGLMAAREEFGKSQPLKGARISGSLHMTIQTAVLIETLKVLGAEVRWASCNIFSTQDHAAAAIAATGTPVFAVKGETLEEYWTYTDQIFQWPDGEPSNMILDDGGDATMYILIGARAE 147          
The following BLAST results are available for this feature:
BLAST of FC876217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_LEPBJ1.861e-4359.86Adenosylhomocysteinase OS=Leptospira borgpeterseni... [more]
SAHH_SYNS32.431e-4355.13Adenosylhomocysteinase OS=Synechococcus sp. (strai... [more]
SAHH_RALME2.431e-4359.03Adenosylhomocysteinase OS=Ralstonia metallidurans ... [more]
SAHH_COREF2.431e-4351.38Adenosylhomocysteinase OS=Corynebacterium efficien... [more]
SAHH_XYLFT5.416e-4356.58Adenosylhomocysteinase OS=Xylella fastidiosa (stra... [more]
SAHH_XYLF25.416e-4356.58Adenosylhomocysteinase OS=Xylella fastidiosa (stra... [more]
SAHH_SYNSC5.416e-4358.62Adenosylhomocysteinase OS=Synechococcus sp. (strai... [more]
SAHH_LEPIN5.416e-4359.86Adenosylhomocysteinase OS=Leptospira interrogans G... [more]
SAHH_LEPIC5.416e-4359.86Adenosylhomocysteinase OS=Leptospira interrogans s... [more]
SAHH_BRUSU5.416e-4359.31Adenosylhomocysteinase OS=Brucella suis GN=ahcY PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H01EF DevOvary1 Citrus clementina cDNA clone C32001H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876217 ID=FC876217|Name=FC876217|organism=Citrus clementina|type=EST|length=640bp
GTGGTCGGGTTCACAAAGAGAGAGTATAGTGACCTCTCTTCCTTCTTCCT
TTTAGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAA
TCCGCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTT
CGGCCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGG
CTTGCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATC
ACCGGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCT
CACCGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAA
CCCAAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTT
GCCTGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGC
CCTGGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTG
GTGACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTAC
GAGAAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACTACGCCGAGTT
TCAGATTGTTTTGACTATCATTAGAGATGGGTTGAAGGCC
back to top