FC876217

Overview
NameFC876217
Unique NameFC876217
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:50..689. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BRUSI (Adenosylhomocysteinase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=ahcY PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 5.416e-43
Identity = 86/145 (59.31%), Postives = 104/145 (71.72%), Query Frame = 2
Query:  107 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            + ++F VKD+S AD+GR E+++AE EMPGLMA R EFG SQP KGA+I+GSLHMTIQTAVLIETL  LGAEVRW SCNIFSTQDH               KGETL+EYW  T++   W  G   ++I+DDGGDAT+ I  G +AE
Sbjct:    3 ASQDFVVKDISLADWGRKELDIAETEMPGLMAAREEFGKSQPLKGARISGSLHMTIQTAVLIETLKVLGAEVRWASCNIFSTQDHAAAAIAATGTPVFAVKGETLEEYWTYTDQIFQWPDGEPSNMILDDGGDATMYILIGARAE 147          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BRUO2 (Adenosylhomocysteinase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=ahcY PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 5.416e-43
Identity = 86/145 (59.31%), Postives = 104/145 (71.72%), Query Frame = 2
Query:  107 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            + ++F VKD+S AD+GR E+++AE EMPGLMA R EFG SQP KGA+I+GSLHMTIQTAVLIETL  LGAEVRW SCNIFSTQDH               KGETL+EYW  T++   W  G   ++I+DDGGDAT+ I  G +AE
Sbjct:    3 ASQDFVVKDISLADWGRKELDIAETEMPGLMAAREEFGKSQPLKGARISGSLHMTIQTAVLIETLKVLGAEVRWASCNIFSTQDHAAAAIAATGTPVFAVKGETLEEYWTYTDQIFQWPDGEPSNMILDDGGDATMYILIGARAE 147          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BRUME (Adenosylhomocysteinase OS=Brucella melitensis GN=ahcY PE=3 SV=2)

HSP 1 Score: 174.096 bits (440), Expect = 5.416e-43
Identity = 86/145 (59.31%), Postives = 104/145 (71.72%), Query Frame = 2
Query:  107 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            + ++F VKD+S AD+GR E+++AE EMPGLMA R EFG SQP KGA+I+GSLHMTIQTAVLIETL  LGAEVRW SCNIFSTQDH               KGETL+EYW  T++   W  G   ++I+DDGGDAT+ I  G +AE
Sbjct:    3 ASQDFVVKDISLADWGRRELDIAETEMPGLMAAREEFGKSQPLKGARISGSLHMTIQTAVLIETLKVLGAEVRWASCNIFSTQDHAAAAIAATGTPVFAVKGETLEEYWTYTDQIFQWPDGEPSNMILDDGGDATMYILIGARAE 147          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BRUMB (Adenosylhomocysteinase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=ahcY PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 5.416e-43
Identity = 86/145 (59.31%), Postives = 104/145 (71.72%), Query Frame = 2
Query:  107 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            + ++F VKD+S AD+GR E+++AE EMPGLMA R EFG SQP KGA+I+GSLHMTIQTAVLIETL  LGAEVRW SCNIFSTQDH               KGETL+EYW  T++   W  G   ++I+DDGGDAT+ I  G +AE
Sbjct:    3 ASQDFVVKDISLADWGRRELDIAETEMPGLMAAREEFGKSQPLKGARISGSLHMTIQTAVLIETLKVLGAEVRWASCNIFSTQDHAAAAIAATGTPVFAVKGETLEEYWTYTDQIFQWPDGEPSNMILDDGGDATMYILIGARAE 147          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BRUC2 (Adenosylhomocysteinase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=ahcY PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 5.416e-43
Identity = 86/145 (59.31%), Postives = 104/145 (71.72%), Query Frame = 2
Query:  107 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            + ++F VKD+S AD+GR E+++AE EMPGLMA R EFG SQP KGA+I+GSLHMTIQTAVLIETL  LGAEVRW SCNIFSTQDH               KGETL+EYW  T++   W  G   ++I+DDGGDAT+ I  G +AE
Sbjct:    3 ASQDFVVKDISLADWGRKELDIAETEMPGLMAAREEFGKSQPLKGARISGSLHMTIQTAVLIETLKVLGAEVRWASCNIFSTQDHAAAAIAATGTPVFAVKGETLEEYWTYTDQIFQWPDGEPSNMILDDGGDATMYILIGARAE 147          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BRUAB (Adenosylhomocysteinase OS=Brucella abortus GN=ahcY PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 5.416e-43
Identity = 86/145 (59.31%), Postives = 104/145 (71.72%), Query Frame = 2
Query:  107 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            + ++F VKD+S AD+GR E+++AE EMPGLMA R EFG SQP KGA+I+GSLHMTIQTAVLIETL  LGAEVRW SCNIFSTQDH               KGETL+EYW  T++   W  G   ++I+DDGGDAT+ I  G +AE
Sbjct:    3 ASQDFVVKDISLADWGRKELDIAETEMPGLMAAREEFGKSQPLKGARISGSLHMTIQTAVLIETLKVLGAEVRWASCNIFSTQDHAAAAIAATGTPVFAVKGETLEEYWTYTDQIFQWPDGEPSNMILDDGGDATMYILIGARAE 147          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BRUA2 (Adenosylhomocysteinase OS=Brucella abortus (strain 2308) GN=ahcY PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 5.416e-43
Identity = 86/145 (59.31%), Postives = 104/145 (71.72%), Query Frame = 2
Query:  107 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            + ++F VKD+S AD+GR E+++AE EMPGLMA R EFG SQP KGA+I+GSLHMTIQTAVLIETL  LGAEVRW SCNIFSTQDH               KGETL+EYW  T++   W  G   ++I+DDGGDAT+ I  G +AE
Sbjct:    3 ASQDFVVKDISLADWGRKELDIAETEMPGLMAAREEFGKSQPLKGARISGSLHMTIQTAVLIETLKVLGAEVRWASCNIFSTQDHAAAAIAATGTPVFAVKGETLEEYWTYTDQIFQWPDGEPSNMILDDGGDATMYILIGARAE 147          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BRUA1 (Adenosylhomocysteinase OS=Brucella abortus (strain S19) GN=ahcY PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 5.416e-43
Identity = 86/145 (59.31%), Postives = 104/145 (71.72%), Query Frame = 2
Query:  107 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            + ++F VKD+S AD+GR E+++AE EMPGLMA R EFG SQP KGA+I+GSLHMTIQTAVLIETL  LGAEVRW SCNIFSTQDH               KGETL+EYW  T++   W  G   ++I+DDGGDAT+ I  G +AE
Sbjct:    3 ASQDFVVKDISLADWGRKELDIAETEMPGLMAAREEFGKSQPLKGARISGSLHMTIQTAVLIETLKVLGAEVRWASCNIFSTQDHAAAAIAATGTPVFAVKGETLEEYWTYTDQIFQWPDGEPSNMILDDGGDATMYILIGARAE 147          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_MYXXD (Adenosylhomocysteinase OS=Myxococcus xanthus (strain DK 1622) GN=ahcY PE=3 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 7.073e-43
Identity = 86/148 (58.11%), Postives = 107/148 (72.30%), Query Frame = 2
Query:  113 REFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGG----GPDLIVDDGGDATLLIHEGVKAEE 544
            +++ + DLS AD+GR EI +AE EMP LMA R E+  +QP KGA++TGSLHMTIQTAVL+ETL ALGAEVRW SCNIFSTQDH               KGE+L+EYW  T +  D+GP G    GP++I+DDGGDATLL+H G +AE+
Sbjct:   10 QDYAIADLSLADWGRKEIRIAESEMPALMAIREEYAKTQPLKGARVTGSLHMTIQTAVLVETLQALGAEVRWASCNIFSTQDHAAAALVQAGTPVFAHKGESLKEYWDFTHRIFDFGPAGSDHEGPNMILDDGGDATLLMHLGKRAEK 157          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_ACIAC (Adenosylhomocysteinase OS=Acidovorax avenae subsp. citrulli (strain AAC00-1) GN=ahcY PE=3 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 7.073e-43
Identity = 87/147 (59.18%), Postives = 107/147 (72.79%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWG----PGGGPDLIVDDGGDATLLIHEGVKAEE 544
            +  + D+S AD+GR EI++AE EMPGLMA R EF  +QP KGA+ITGSLHMTIQTAVLIETL ALGA+VRW SCNIFSTQDH               KGE+L++YW  T +  D+G    PG GP++I+DDGGDATLL+H G +AE+
Sbjct:   10 DLAIADISLADWGRKEIKIAETEMPGLMAIREEFAAAQPLKGARITGSLHMTIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAIAAGGTPVFAIKGESLEDYWDYTHRIFDFGAKGTPGEGPNMILDDGGDATLLMHLGQRAEK 156          
The following BLAST results are available for this feature:
BLAST of FC876217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_BRUSI5.416e-4359.31Adenosylhomocysteinase OS=Brucella suis (strain AT... [more]
SAHH_BRUO25.416e-4359.31Adenosylhomocysteinase OS=Brucella ovis (strain AT... [more]
SAHH_BRUME5.416e-4359.31Adenosylhomocysteinase OS=Brucella melitensis GN=a... [more]
SAHH_BRUMB5.416e-4359.31Adenosylhomocysteinase OS=Brucella melitensis biot... [more]
SAHH_BRUC25.416e-4359.31Adenosylhomocysteinase OS=Brucella canis (strain A... [more]
SAHH_BRUAB5.416e-4359.31Adenosylhomocysteinase OS=Brucella abortus GN=ahcY... [more]
SAHH_BRUA25.416e-4359.31Adenosylhomocysteinase OS=Brucella abortus (strain... [more]
SAHH_BRUA15.416e-4359.31Adenosylhomocysteinase OS=Brucella abortus (strain... [more]
SAHH_MYXXD7.073e-4358.11Adenosylhomocysteinase OS=Myxococcus xanthus (stra... [more]
SAHH_ACIAC7.073e-4359.18Adenosylhomocysteinase OS=Acidovorax avenae subsp.... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H01EF DevOvary1 Citrus clementina cDNA clone C32001H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876217 ID=FC876217|Name=FC876217|organism=Citrus clementina|type=EST|length=640bp
GTGGTCGGGTTCACAAAGAGAGAGTATAGTGACCTCTCTTCCTTCTTCCT
TTTAGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAA
TCCGCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTT
CGGCCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGG
CTTGCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATC
ACCGGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCT
CACCGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAA
CCCAAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTT
GCCTGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGC
CCTGGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTG
GTGACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTAC
GAGAAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACTACGCCGAGTT
TCAGATTGTTTTGACTATCATTAGAGATGGGTTGAAGGCC
back to top