FC876218

Overview
NameFC876218
Unique NameFC876218
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length675
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..681. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSD_PETHY (Chalcone synthase D OS=Petunia hybrida GN=CHSD PE=3 SV=2)

HSP 1 Score: 301.597 bits (771), Expect = 9.637e-90
Identity = 146/181 (80.66%), Postives = 164/181 (90.61%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV+E+RNAQRA+GPATVLAIGTATP++ V+Q+ YPDYYFRIT SEH TELKEKFKR+CDKSMIKKRYM+LTE+ILKENPN+C  MAPSLDAR +I  VEVPKLGKEAA KAI+EW QPKS+ITHL+FCTT+GV MPGAD+QLTKL+GL  SVKRFMM Q GCFAGGTVLRLAKDLAENN
Sbjct:    1 MVTVEEVRNAQRAEGPATVLAIGTATPSNCVDQSTYPDYYFRITDSEHKTELKEKFKRICDKSMIKKRYMHLTEKILKENPNICESMAPSLDARTNIYAVEVPKLGKEAAEKAIEEWNQPKSRITHLVFCTTTGVSMPGADFQLTKLLGLGSSVKRFMMNQLGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 50.447 bits (119), Expect = 9.637e-90
Identity = 23/27 (85.19%), Postives = 24/27 (88.89%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEIT VTFRGP DTH DS
Sbjct:  182 KGARVLVVCSEITVVTFRGPNDTHFDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS1_DAUCA (Chalcone synthase 1 OS=Daucus carota GN=CHS1 PE=2 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 1.641e-89
Identity = 147/181 (81.22%), Postives = 162/181 (89.50%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV E R AQRA+GPATVLAIGTATP + V+Q+ Y DYYFRIT SE   ELKEKF+RMC+KSMI  RYM+LTE++LK+NP+ C YMA SLDARQDIVV EVPKLGKEAA +AIKEWGQPKSKITHLIFCTTSGVDMPGAD++LTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVTVNEFRKAQRAEGPATVLAIGTATPPNCVDQSAYADYYFRITNSEDKPELKEKFRRMCEKSMINTRYMHLTEDLLKQNPSFCEYMASSLDARQDIVVNEVPKLGKEAALRAIKEWGQPKSKITHLIFCTTSGVDMPGADFRLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 49.2914 bits (116), Expect = 1.641e-89
Identity = 22/27 (81.48%), Postives = 24/27 (88.89%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            + ARVLVVCSEIT +TFRGP DTHLDS
Sbjct:  182 KNARVLVVCSEITVITFRGPNDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS9_DAUCA (Chalcone synthase 9 OS=Daucus carota GN=CHS9 PE=2 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 4.751e-89
Identity = 146/181 (80.66%), Postives = 162/181 (89.50%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV E R AQRA+GPATVLAIGTATP + V+Q+ Y DYYFRIT SE   ELKEKF+RMC+KSMI  RYM+LTE++LK+NP+ C YMA SLDARQDIVV EVPKLGKEAA +AIKEWG+PKSKITHLIFCTTSGVDMPGAD++LTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVTVNEFRKAQRAEGPATVLAIGTATPPNCVDQSAYADYYFRITNSEDKPELKEKFRRMCEKSMINTRYMHLTEDLLKQNPSFCEYMASSLDARQDIVVNEVPKLGKEAALRAIKEWGRPKSKITHLIFCTTSGVDMPGADFRLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 49.2914 bits (116), Expect = 4.751e-89
Identity = 22/27 (81.48%), Postives = 24/27 (88.89%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            + ARVLVVCSEIT +TFRGP DTHLDS
Sbjct:  182 KNARVLVVCSEITVITFRGPNDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: THS2_VITVI (Stilbene synthase 2 OS=Vitis vinifera GN=GSVIVT00004047001 PE=2 SV=2)

HSP 1 Score: 296.204 bits (757), Expect = 1.646e-86
Identity = 139/181 (76.80%), Postives = 163/181 (90.06%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            MA+V+EIRNAQRA GPAT+LAIGTATP H V Q+DY DYYFR+TKSEHMT LK+KF R+CDKSMIKKRY++LTEE+L+E+PN+ AYMAPSL+ RQ+I+  EVPKLGKEAA KA+KEWGQPKSKITHL+FCTTSGV+MPGADY+L  L+GL PSV+R M+Y QGC+AGGTVLR AKDLAENN
Sbjct:    1 MASVEEIRNAQRAKGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTALKKKFNRICDKSMIKKRYIHLTEEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTSGVEMPGADYKLANLLGLEPSVRRVMLYHQGCYAGGTVLRTAKDLAENN 181          

HSP 2 Score: 45.0542 bits (105), Expect = 1.646e-86
Identity = 21/26 (80.77%), Postives = 23/26 (88.46%), Query Frame = 1
Query:  598 GARVLVVCSEITAVTFRGPADTHLDS 675
            GARVLVVCSEIT VTFRGP++  LDS
Sbjct:  183 GARVLVVCSEITVVTFRGPSEDALDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: THS5_VITVI (Stilbene synthase 5 OS=Vitis vinifera GN=GSVIVT00007357001 PE=3 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 6.215e-86
Identity = 138/181 (76.24%), Postives = 163/181 (90.06%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            MA+V+EIRNAQRA GPAT+LAIGTATP H V Q+DY DYYF++TKSEHMTELK+KF R+CDKSMIKKRY++LTEE+L+E+PN+ AYMAPSL+ RQ+I+  EVPKLGKEAA KA+KEWGQPKSKITHL+FCTTSGV+MPGADY+L  L+GL  SV+R M+Y QGC+AGGTVLR AKDLAENN
Sbjct:    1 MASVEEIRNAQRAKGPATILAIGTATPDHCVYQSDYADYYFKVTKSEHMTELKKKFNRICDKSMIKKRYIHLTEEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTSGVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENN 181          

HSP 2 Score: 45.0542 bits (105), Expect = 6.215e-86
Identity = 21/26 (80.77%), Postives = 23/26 (88.46%), Query Frame = 1
Query:  598 GARVLVVCSEITAVTFRGPADTHLDS 675
            GARVLVVCSEIT VTFRGP++  LDS
Sbjct:  183 GARVLVVCSEITVVTFRGPSEDALDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: THS4_VITVI (Stilbene synthase 4 OS=Vitis vinifera GN=GSVIVT00005194001 PE=3 SV=1)

HSP 1 Score: 293.508 bits (750), Expect = 1.057e-85
Identity = 138/181 (76.24%), Postives = 164/181 (90.61%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            MA+V+EIRNAQRA GPATVLAIGTATP + + Q+D+ DYYFR+TKSEHMTELK+KF R+CDKSMIKKRY++LTEE+L+E+PN+ AYMAPSL+ RQ+I+  EVPKLGKEAA KA+KEWGQPKSKITHL+FCTTSGV+MPGADY+L  L+GL PSV+R M+Y QGC+AGGTVLR AKDLAENN
Sbjct:    1 MASVEEIRNAQRAKGPATVLAIGTATPDNCLYQSDFADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLTEEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTSGVEMPGADYKLANLLGLEPSVRRVMLYHQGCYAGGTVLRTAKDLAENN 181          

HSP 2 Score: 45.0542 bits (105), Expect = 1.057e-85
Identity = 21/26 (80.77%), Postives = 23/26 (88.46%), Query Frame = 1
Query:  598 GARVLVVCSEITAVTFRGPADTHLDS 675
            GARVLVVCSEIT VTFRGP++  LDS
Sbjct:  183 GARVLVVCSEITVVTFRGPSEDALDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: VPS_HUMLU (Phloroisovalerophenone synthase OS=Humulus lupulus GN=VPS PE=2 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 2.347e-85
Identity = 136/179 (75.98%), Postives = 161/179 (89.94%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            TV++IR AQRA+GPAT+LAIGTA PA+  NQAD+PDYYFR+TKSEHMT+LK+KF+RMC+KS IKKRY++LTEE LK+NP++C Y APSL+ RQD++VVEVPKLGKEAA  AIKEWGQPKSKITHLIFCT S +DMPGADYQ  KL+GLRPSVKR M+YQ GC+AGG VLR+AKD+AENN
Sbjct:    5 TVEQIRKAQRAEGPATILAIGTAVPANCFNQADFPDYYFRVTKSEHMTDLKKKFQRMCEKSTIKKRYLHLTEEHLKQNPHLCEYNAPSLNTRQDMLVVEVPKLGKEAAINAIKEWGQPKSKITHLIFCTGSSIDMPGADYQCAKLLGLRPSVKRVMLYQLGCYAGGKVLRIAKDIAENN 183          

HSP 2 Score: 44.669 bits (104), Expect = 2.347e-85
Identity = 19/26 (73.08%), Postives = 23/26 (88.46%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLD 672
            +GARVL+VCSEITA  FRGP++ HLD
Sbjct:  184 KGARVLIVCSEITACIFRGPSEKHLD 209          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSF_PETHY (Chalcone synthase F OS=Petunia hybrida GN=CHSF PE=2 SV=2)

HSP 1 Score: 293.123 bits (749), Expect = 3.994e-85
Identity = 139/181 (76.80%), Postives = 160/181 (88.40%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V+E+R AQR +GPAT+LAIGTATP + V+Q  YPDY+FR+T S+H TELKEKFKRM ++SMIKK Y++LTEEILKENP++C + APS DARQDIVVVEVPKLGKEAA  AIKEWGQPKSKITHL+FCTT+GVDM GADYQLTKL+GL PSVKR MMYQ GC+ GGTVLRLAKDLAENN
Sbjct:    1 MVSVEEVRRAQRREGPATILAIGTATPLNCVDQTTYPDYFFRVTNSDHKTELKEKFKRMFERSMIKKSYLHLTEEILKENPSICEHKAPSFDARQDIVVVEVPKLGKEAAQNAIKEWGQPKSKITHLVFCTTTGVDMHGADYQLTKLLGLSPSVKRLMMYQLGCYGGGTVLRLAKDLAENN 181          

HSP 2 Score: 43.5134 bits (101), Expect = 3.994e-85
Identity = 19/26 (73.08%), Postives = 22/26 (84.62%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLD 672
            +GAR LVVCSEITA+TF  P+DT LD
Sbjct:  182 KGARALVVCSEITAITFHAPSDTDLD 207          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSY_EQUAR (Chalcone synthase OS=Equisetum arvense GN=CHS PE=2 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 8.862e-85
Identity = 139/182 (76.37%), Postives = 153/182 (84.07%), Query Frame = 2
Query:   50 EMATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            E A     R AQRA+GPATVLAIGTA PA+   Q+ YPD+YF IT S+HMTELK KF RMC KS IKKRYM+L  EILK NP++CAY   SLD RQDI VVEVPKLGKEA+ KAIKEWGQPKSKITHL+FCTTSGVDMPGAD+ LTKL+GLRPSVKR MMYQQGCFAGGTVLR+AKD+AENN
Sbjct:    6 ESADASSRRLAQRANGPATVLAIGTANPANVFEQSSYPDFYFDITNSQHMTELKLKFSRMCQKSGIKKRYMHLNSEILKANPSLCAYWEKSLDVRQDIAVVEVPKLGKEASLKAIKEWGQPKSKITHLVFCTTSGVDMPGADWALTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDVAENN 187          

HSP 2 Score: 51.6026 bits (122), Expect = 8.862e-85
Identity = 23/27 (85.19%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEIT VTFRGP++THLDS
Sbjct:  188 KGARVLVVCSEITCVTFRGPSETHLDS 214          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: THS7_VITVI (Stilbene synthase 6 OS=Vitis vinifera GN=STS PE=2 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 8.864e-85
Identity = 135/181 (74.59%), Postives = 162/181 (89.50%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            MA+V+E RNAQRA GPAT+LAIGTATP H V Q+DY DYYFR+TKSEHMTELK+KF R+CDKSMIKKRY++LTEE+L+E+PN+ AYMAPSL+ RQ+I+  EVP+LG++AA KA+KEWGQPKSKITHL+FCTTSGV+MPGADY+L  L+GL  SV+R M+Y QGC+AGGTVLR AKDLAENN
Sbjct:    1 MASVEEFRNAQRAKGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLTEEMLEEHPNIGAYMAPSLNIRQEIITAEVPRLGRDAALKALKEWGQPKSKITHLVFCTTSGVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENN 181          

HSP 2 Score: 45.0542 bits (105), Expect = 8.864e-85
Identity = 21/26 (80.77%), Postives = 23/26 (88.46%), Query Frame = 1
Query:  598 GARVLVVCSEITAVTFRGPADTHLDS 675
            GARVLVVCSEIT VTFRGP++  LDS
Sbjct:  183 GARVLVVCSEITVVTFRGPSEDALDS 208          
The following BLAST results are available for this feature:
BLAST of FC876218 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHSD_PETHY9.637e-9080.66Chalcone synthase D OS=Petunia hybrida GN=CHSD PE=... [more]
CHS1_DAUCA1.641e-8981.22Chalcone synthase 1 OS=Daucus carota GN=CHS1 PE=2 ... [more]
CHS9_DAUCA4.751e-8980.66Chalcone synthase 9 OS=Daucus carota GN=CHS9 PE=2 ... [more]
THS2_VITVI1.646e-8676.80Stilbene synthase 2 OS=Vitis vinifera GN=GSVIVT000... [more]
THS5_VITVI6.215e-8676.24Stilbene synthase 5 OS=Vitis vinifera GN=GSVIVT000... [more]
THS4_VITVI1.057e-8576.24Stilbene synthase 4 OS=Vitis vinifera GN=GSVIVT000... [more]
VPS_HUMLU2.347e-8575.98Phloroisovalerophenone synthase OS=Humulus lupulus... [more]
CHSF_PETHY3.994e-8576.80Chalcone synthase F OS=Petunia hybrida GN=CHSF PE=... [more]
CHSY_EQUAR8.862e-8576.37Chalcone synthase OS=Equisetum arvense GN=CHS PE=2... [more]
THS7_VITVI8.864e-8574.59Stilbene synthase 6 OS=Vitis vinifera GN=STS PE=2 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H02EF DevOvary1 Citrus clementina cDNA clone C32001H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876218 ID=FC876218|Name=FC876218|organism=Citrus clementina|type=EST|length=675bp
GACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGTGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCGGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCT
back to top