FC876218

Overview
NameFC876218
Unique NameFC876218
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length675
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..681. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSA_IPOCO (Chalcone synthase A (Fragment) OS=Ipomoea cordatotriloba GN=CHSA PE=3 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 8.825e-70
Identity = 122/172 (70.93%), Postives = 145/172 (84.30%), Query Frame = 2
Query:   80 AQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            A+R +G A +LAIGTATP + V+QA YPD+YFRIT SEH+ E KEKF+R+C+KS I+KR++ LTEE+LKENPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRL K LAENN
Sbjct:   14 AKRFEGHAKLLAIGTATPTNWVDQATYPDFYFRITNSEHLLEHKEKFRRICNKSKIRKRHLVLTEELLKENPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLVKGLAENN 185          

HSP 2 Score: 32.3426 bits (72), Expect = 8.825e-70
Identity = 15/21 (71.43%), Postives = 17/21 (80.95%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPA 657
            +GARVLVVCS IT   FRGP+
Sbjct:  186 KGARVLVVCSGITINIFRGPS 206          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSB_IPONI (Chalcone synthase B (Fragment) OS=Ipomoea nil GN=CHSB PE=3 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 1.957e-69
Identity = 119/172 (69.19%), Postives = 146/172 (84.88%), Query Frame = 2
Query:   80 AQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            A++ +G A + AIGTATPA+ V+Q  YPD+YFRIT S+H+ E KEKF+R+C+KS I+KR++ LTEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRLAKDLAE+N
Sbjct:   16 AKKLEGDAKIWAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIRKRHLVLTEELLKKNPNLCTYNETSLNTRQDILVAEVPKLGKEAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAESN 187          

HSP 2 Score: 32.3426 bits (72), Expect = 1.957e-69
Identity = 14/21 (66.67%), Postives = 17/21 (80.95%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPA 657
            +G RVLVVC+EIT   FRGP+
Sbjct:  188 KGGRVLVVCAEITINIFRGPS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSB_IPOTF (Chalcone synthase B (Fragment) OS=Ipomoea trifida GN=CHSB PE=3 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 3.328e-69
Identity = 123/176 (69.89%), Postives = 147/176 (83.52%), Query Frame = 2
Query:   74 RNAQR--ADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            R A+R   +G A +LAIGTATPA+ V+Q  YPD+YFRIT S+H+ E KEKF+R+C+KS I+KR+M LTEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIK WG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRLAKDLAENN
Sbjct:   14 RRAKRFEIEGYAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSNIRKRHMVLTEELLKKNPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKAIKVWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENN 189          

HSP 2 Score: 33.113 bits (74), Expect = 3.328e-69
Identity = 14/21 (66.67%), Postives = 17/21 (80.95%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPA 657
            +GARVLVVCSE+    FRGP+
Sbjct:  190 KGARVLVVCSEVMLSVFRGPS 210          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSC_IPOPU (Chalcone synthase C (Fragment) OS=Ipomoea purpurea GN=CHSC PE=3 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 1.256e-68
Identity = 119/174 (68.39%), Postives = 144/174 (82.76%), Query Frame = 2
Query:   74 RNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            R  +R DG A +LAIGTA PA+ V+Q  YPD+YFRIT SEH+ E KEKF+R+C+KS I+KR++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCT+SGVDMPGAD+QL KL+GL  SV R MMYQQGC AG  +LRLAKDLAENN
Sbjct:   14 RREKRFDGHAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEYKEKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVNRLMMYQQGCNAGAVMLRLAKDLAENN 187          

HSP 2 Score: 31.5722 bits (70), Expect = 1.256e-68
Identity = 13/21 (61.90%), Postives = 16/21 (76.19%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPA 657
            +G RVLVVCSE+    FRGP+
Sbjct:  188 KGGRVLVVCSEVMLSVFRGPS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSA_IPOTR (Chalcone synthase A (Fragment) OS=Ipomoea triloba GN=CHSA PE=3 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 1.637e-68
Identity = 119/172 (69.19%), Postives = 144/172 (83.72%), Query Frame = 2
Query:   80 AQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            A+R +G A +LAIGTATP + V+QA YPD+YFRIT SE + E KEKF+R+C+KS I+ R++ LTEE+LK++PN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRL KDLAENN
Sbjct:   14 AKRFEGHAKLLAIGTATPTNWVDQATYPDFYFRITNSERLLEHKEKFRRICNKSKIRFRHLVLTEELLKKSPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLVKDLAENN 185          

HSP 2 Score: 35.039 bits (79), Expect = 1.637e-68
Identity = 16/21 (76.19%), Postives = 18/21 (85.71%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPA 657
            +GARVLVVCSEIT   FRGP+
Sbjct:  186 KGARVLVVCSEITINIFRGPS 206          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSA_IPONI (Chalcone synthase A (Fragment) OS=Ipomoea nil GN=CHSA PE=3 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 4.737e-68
Identity = 118/174 (67.82%), Postives = 144/174 (82.76%), Query Frame = 2
Query:   74 RNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            R  +R +G A +LAIGTA PA+ V+Q  YPD+YFRIT SEH+ E KEKF+R+C+KS I+KR++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCT+SGVDMPGAD+QL KL+GL  SV R MMYQQGC AG  +LRLAKDLAENN
Sbjct:   11 RREKRIEGHAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVNRLMMYQQGCNAGAAMLRLAKDLAENN 184          

HSP 2 Score: 31.187 bits (69), Expect = 4.737e-68
Identity = 13/21 (61.90%), Postives = 16/21 (76.19%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPA 657
            +G RVLVVCSE+    FRGP+
Sbjct:  185 KGGRVLVVCSEVMLNVFRGPS 205          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSB_IPOTR (Chalcone synthase B (Fragment) OS=Ipomoea triloba GN=CHSB PE=3 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 8.051e-68
Identity = 119/176 (67.61%), Postives = 148/176 (84.09%), Query Frame = 2
Query:   74 RNAQR--ADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            R A+R   +G A +LAIGTATPA+ V+Q  YPD+YFRIT S+H+ E KEKF+R+C+KS I+KR++ LTEE+L++NP++C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD++LTKL+GL  SVKR MMYQQGC AG  +LRLAKDLAE+N
Sbjct:   14 RRAKRFEIEGYAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIRKRHLVLTEELLQKNPSLCTYNETSLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFRLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAESN 189          

HSP 2 Score: 33.113 bits (74), Expect = 8.051e-68
Identity = 14/21 (66.67%), Postives = 17/21 (80.95%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPA 657
            +G R+LVVCSEIT   FRGP+
Sbjct:  190 KGGRILVVCSEITINIFRGPS 210          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: TBSYN_HYPAN (Trihydroxybenzophenone synthase OS=Hypericum androsaemum PE=1 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 1.144e-66
Identity = 115/165 (69.70%), Postives = 133/165 (80.61%), Query Frame = 2
Query:  101 ATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            A+VLAIGT  P H + Q DYPD+YFR T SEHMTELKEKFKR+C KS I+KR+ YLTEEILKEN  +  Y A SLDARQ I+  EVPKLG+EAA KAI EWGQP SKITH++F TTSG  MPGADY +T+L+GL  +V+R M+Y QGCFAGGT LR+AKDLAENN
Sbjct:   20 ASVLAIGTTNPEHFILQEDYPDFYFRNTNSEHMTELKEKFKRICVKSHIRKRHFYLTEEILKENQGIATYGAGSLDARQRILETEVPKLGQEAALKAIAEWGQPISKITHVVFATTSGFMMPGADYVITRLLGLNRTVRRVMLYNQGCFAGGTALRVAKDLAENN 184          

HSP 2 Score: 40.0466 bits (92), Expect = 1.144e-66
Identity = 17/26 (65.38%), Postives = 22/26 (84.62%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLD 672
            +GARVLVVC+E TA+TF  P ++HLD
Sbjct:  185 EGARVLVVCAENTAMTFHAPNESHLD 210          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: BBS_PHASS (Bibenzyl synthase OS=Phalaenopsis sp. GN=BIBSY212 PE=2 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 5.626e-66
Identity = 106/180 (58.89%), Postives = 145/180 (80.56%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN 592
            M +++ I+ A RADG A++LAIG A P + + Q+ YPD+YFR+T SEH+ +LK+KF+R+C+K+ I+KR+    EE L  NP    +M  SL+ RQ++ + E+PKLG +AATKAI++WGQPKS+ITHLIFCTTSG+D+PGADYQLT+++GL P+V+R M+YQQGCFAGGT LRLAK LAE+
Sbjct:    1 MLSLESIKKAPRADGFASILAIGRANPDNIIEQSAYPDFYFRVTNSEHLVDLKKKFQRICEKTAIRKRHFVWNEEFLTANPCFSTFMDKSLNVRQEVAISEIPKLGAKAATKAIEDWGQPKSRITHLIFCTTSGMDLPGADYQLTQILGLNPNVERVMLYQQGCFAGGTTLRLAKCLAES 180          

HSP 2 Score: 38.1206 bits (87), Expect = 5.626e-66
Identity = 16/27 (59.26%), Postives = 21/27 (77.78%), Query Frame = 1
Query:  592 QQGARVLVVCSEITAVTFRGPADTHLD 672
            ++GARVLVVC+E T V FR P++ H D
Sbjct:  181 RKGARVLVVCAETTTVLFRAPSEEHQD 207          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: VPS_PSINU (Phloroisovalerophenone synthase OS=Psilotum nudum GN=VPS PE=2 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 2.121e-65
Identity = 112/174 (64.37%), Postives = 139/174 (79.89%), Query Frame = 2
Query:   74 RNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            R  +RA GP +VLAIG+A P +  +Q+ +PD+YF IT+S HM E+K KF RMC KS IKKR M++ E+IL+ +P++ +Y   SLD RQD++V EVPKLGK AA  AI EWGQPKS ITHLIFCT+SG+DMPGAD+ L KL+GLRP+V R M+YQQGCFAG TVLR+AKDLAENN
Sbjct:   15 RKKERASGPVSVLAIGSANPPNVFHQSLFPDFYFNITQSNHMAEVKAKFTRMCAKSGIKKRRMHINEDILEAHPSIRSYHDNSLDVRQDMLVEEVPKLGKVAADNAIAEWGQPKSNITHLIFCTSSGIDMPGADWALMKLLGLRPTVNRVMVYQQGCFAGCTVLRIAKDLAENN 188          

HSP 2 Score: 38.891 bits (89), Expect = 2.121e-65
Identity = 14/24 (58.33%), Postives = 21/24 (87.50%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTH 666
            +G+R+LVVCSE+T ++FRGP + H
Sbjct:  189 KGSRILVVCSELTLISFRGPTEDH 212          
The following BLAST results are available for this feature:
BLAST of FC876218 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHSA_IPOCO8.825e-7070.93Chalcone synthase A (Fragment) OS=Ipomoea cordatot... [more]
CHSB_IPONI1.957e-6969.19Chalcone synthase B (Fragment) OS=Ipomoea nil GN=C... [more]
CHSB_IPOTF3.328e-6969.89Chalcone synthase B (Fragment) OS=Ipomoea trifida ... [more]
CHSC_IPOPU1.256e-6868.39Chalcone synthase C (Fragment) OS=Ipomoea purpurea... [more]
CHSA_IPOTR1.637e-6869.19Chalcone synthase A (Fragment) OS=Ipomoea triloba ... [more]
CHSA_IPONI4.737e-6867.82Chalcone synthase A (Fragment) OS=Ipomoea nil GN=C... [more]
CHSB_IPOTR8.051e-6867.61Chalcone synthase B (Fragment) OS=Ipomoea triloba ... [more]
TBSYN_HYPAN1.144e-6669.70Trihydroxybenzophenone synthase OS=Hypericum andro... [more]
BBS_PHASS5.626e-6658.89Bibenzyl synthase OS=Phalaenopsis sp. GN=BIBSY212 ... [more]
VPS_PSINU2.121e-6564.37Phloroisovalerophenone synthase OS=Psilotum nudum ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H02EF DevOvary1 Citrus clementina cDNA clone C32001H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876218 ID=FC876218|Name=FC876218|organism=Citrus clementina|type=EST|length=675bp
GACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGTGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCGGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCT
back to top