FC876218

Overview
NameFC876218
Unique NameFC876218
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length675
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..681. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS7_SOYBN (Chalcone synthase 7 OS=Glycine max GN=CHS7 PE=3 SV=1)

HSP 1 Score: 325.094 bits (832), Expect = 4.685e-98
Identity = 157/181 (86.74%), Postives = 168/181 (92.82%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V EIR AQRA+GPAT+LAIGTA P + V+Q+ YPDYYFRIT S+HMTELKEKF+RMCDKSMIK RYMYL EEILKENPNMCAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTK +GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVAEIRQAQRAEGPATILAIGTANPPNRVDQSTYPDYYFRITNSDHMTELKEKFQRMCDKSMIKTRYMYLNEEILKENPNMCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKQLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.6842 bits (130), Expect = 4.685e-98
Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEITAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS3_CAMSI (Chalcone synthase 3 OS=Camellia sinensis GN=CHS3 PE=2 SV=1)

HSP 1 Score: 324.709 bits (831), Expect = 6.112e-98
Identity = 158/181 (87.29%), Postives = 168/181 (92.82%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV+++  AQRA GPATVLAIGTATP + V+Q+ YPDYYFRIT SEH  ELKEKFKRMCDKSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVTVEDVWRAQRARGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCDKSMIKKRYMYLTEEILKENPLVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.6842 bits (130), Expect = 6.112e-98
Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEITAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSY_RAPSA (Chalcone synthase OS=Raphanus sativus GN=CHS PE=2 SV=1)

HSP 1 Score: 324.324 bits (830), Expect = 7.973e-98
Identity = 156/180 (86.67%), Postives = 169/180 (93.89%), Query Frame = 2
Query:   56 ATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            +++ EIR AQRADGPA +LAIGTA PA+ V QA+YPDYYFRIT SEHMT+LKEKFKRMCDKS I+KR+M+LTEE LKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    6 SSLDEIRKAQRADGPAGILAIGTANPANHVLQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRKRHMHLTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 185          

HSP 2 Score: 54.6842 bits (130), Expect = 7.973e-98
Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+DTHLDS
Sbjct:  186 RGARVLVVCSEITAVTFRGPSDTHLDS 212          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS1_CITSI (Chalcone synthase 1 OS=Citrus sinensis GN=CHS1 PE=2 SV=1)

HSP 1 Score: 323.939 bits (829), Expect = 1.040e-97
Identity = 156/181 (86.19%), Postives = 170/181 (93.92%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV E+R AQRA GPAT++AIGTATP + V+Q+ YPDYYFRIT SEHMT+LKEKFKRMCDKSMIKKRYMYLTEEILKENPN+CAYMAPSLD RQD+VVVEVP+LGK AAT+AIKEWGQPKSKITHL+FCTTSGVDMPGADY+LTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVTVDEVRKAQRAQGPATIMAIGTATPPNCVDQSTYPDYYFRITNSEHMTDLKEKFKRMCDKSMIKKRYMYLTEEILKENPNVCAYMAPSLDTRQDMVVVEVPRLGK-AATEAIKEWGQPKSKITHLVFCTTSGVDMPGADYRLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 180          

HSP 2 Score: 54.6842 bits (130), Expect = 1.040e-97
Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+DTHLDS
Sbjct:  181 KGARVLVVCSEITAVTFRGPSDTHLDS 207          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSY_CARAN (Chalcone synthase OS=Cardamine amara GN=CHS PE=3 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 1.357e-97
Identity = 156/179 (87.15%), Postives = 168/179 (93.85%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            ++ EIR AQRADGPA +LAIGTA PA+ V QA+YPDYYFRIT SEHMT+LKEKFKRMCDKS I+KR+M++TEE LKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    8 SLDEIRKAQRADGPAGILAIGTANPANYVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRKRHMHVTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 186          

HSP 2 Score: 54.6842 bits (130), Expect = 1.357e-97
Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+DTHLDS
Sbjct:  187 RGARVLVVCSEITAVTFRGPSDTHLDS 213          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS2_SECCE (Chalcone synthase 2 OS=Secale cereale GN=CHS2 PE=2 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 1.357e-97
Identity = 156/179 (87.15%), Postives = 171/179 (95.53%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            TV+E+R AQRA+GPATVLAIGTATPA+ V QADYPDYYF+ITKS+HM +LKEKFKRMCDKS I+KRYM+LTEEIL++NPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQP+SKITHL+FCTTSGVDMPGADYQLTK++GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    6 TVEEVRKAQRAEGPATVLAIGTATPANCVYQADYPDYYFKITKSDHMADLKEKFKRMCDKSQIRKRYMHLTEEILQDNPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPRSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 184          

HSP 2 Score: 50.447 bits (119), Expect = 1.357e-97
Identity = 23/27 (85.19%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP ++HLDS
Sbjct:  185 RGARVLVVCSEITAVTFRGPHESHLDS 211          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSY_PERFR (Chalcone synthase OS=Perilla frutescens GN=CHS PE=2 SV=1)

HSP 1 Score: 327.02 bits (837), Expect = 1.357e-97
Identity = 157/181 (86.74%), Postives = 171/181 (94.48%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV++IR AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEH T+LKEKFKRMC+KSMI+KRYM+LTEE LKENPNM AYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLR+AKDLAENN
Sbjct:    1 MVTVEDIRRAQRAEGPATVMAIGTATPENCVDQSTYPDYYFRITNSEHRTDLKEKFKRMCEKSMIRKRYMHLTEEFLKENPNMTAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENN 181          

HSP 2 Score: 51.2174 bits (121), Expect = 1.357e-97
Identity = 23/26 (88.46%), Postives = 26/26 (100.00%), Query Frame = 1
Query:  598 GARVLVVCSEITAVTFRGPADTHLDS 675
            GARVLVVCSEITAVTFRGP+++HLDS
Sbjct:  183 GARVLVVCSEITAVTFRGPSESHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSY_CHRAE (Chalcone synthase OS=Chrysosplenium americanum GN=CHS PE=2 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 1.770e-97
Identity = 155/180 (86.11%), Postives = 169/180 (93.89%), Query Frame = 2
Query:   56 ATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            A ++EIRNAQRA+GPAT+LAIGTATPA+ V QADYPD+YFRIT SEH TELKEKF+RMCDKSMIKKRYM+LTE++LKENP MC YMAPSLDARQD+VVVE+ KLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCF GGTVLRLAKDLAENN
Sbjct:    5 ALMEEIRNAQRAEGPATILAIGTATPANCVIQADYPDFYFRITNSEHKTELKEKFQRMCDKSMIKKRYMHLTEDLLKENPKMCEYMAPSLDARQDMVVVEIRKLGKEAAVKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFPGGTVLRLAKDLAENN 184          

HSP 2 Score: 54.6842 bits (130), Expect = 1.770e-97
Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+DTHLDS
Sbjct:  185 RGARVLVVCSEITAVTFRGPSDTHLDS 211          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS3_SINAL (Chalcone synthase 3 OS=Sinapis alba GN=CHS3 PE=2 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 1.770e-97
Identity = 155/180 (86.11%), Postives = 169/180 (93.89%), Query Frame = 2
Query:   56 ATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            +++ EIR AQRADGPA +LAIGTA PA+ V QA+YPDYYFRIT SEHMT+LKEKFKRMCDKS I+KR+M+LTEE LK+NPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    7 SSLDEIRKAQRADGPAGILAIGTANPANHVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRKRHMHLTEEFLKDNPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 186          

HSP 2 Score: 54.6842 bits (130), Expect = 1.770e-97
Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+DTHLDS
Sbjct:  187 RGARVLVVCSEITAVTFRGPSDTHLDS 213          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS1_SINAL (Chalcone synthase 1 OS=Sinapis alba GN=CHS1 PE=2 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 1.770e-97
Identity = 155/180 (86.11%), Postives = 169/180 (93.89%), Query Frame = 2
Query:   56 ATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            +++ EIR AQRADGPA +LAIGTA PA+ V QA+YPDYYFRIT SEHMT+LKEKFKRMCDKS I+KR+M+LTEE LK+NPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    7 SSLDEIRKAQRADGPAGILAIGTANPANHVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRKRHMHLTEEFLKDNPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 186          

HSP 2 Score: 54.6842 bits (130), Expect = 1.770e-97
Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+DTHLDS
Sbjct:  187 RGARVLVVCSEITAVTFRGPSDTHLDS 213          
The following BLAST results are available for this feature:
BLAST of FC876218 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHS7_SOYBN4.685e-9886.74Chalcone synthase 7 OS=Glycine max GN=CHS7 PE=3 SV... [more]
CHS3_CAMSI6.112e-9887.29Chalcone synthase 3 OS=Camellia sinensis GN=CHS3 P... [more]
CHSY_RAPSA7.973e-9886.67Chalcone synthase OS=Raphanus sativus GN=CHS PE=2 ... [more]
CHS1_CITSI1.040e-9786.19Chalcone synthase 1 OS=Citrus sinensis GN=CHS1 PE=... [more]
CHSY_CARAN1.357e-9787.15Chalcone synthase OS=Cardamine amara GN=CHS PE=3 S... [more]
CHS2_SECCE1.357e-9787.15Chalcone synthase 2 OS=Secale cereale GN=CHS2 PE=2... [more]
CHSY_PERFR1.357e-9786.74Chalcone synthase OS=Perilla frutescens GN=CHS PE=... [more]
CHSY_CHRAE1.770e-9786.11Chalcone synthase OS=Chrysosplenium americanum GN=... [more]
CHS3_SINAL1.770e-9786.11Chalcone synthase 3 OS=Sinapis alba GN=CHS3 PE=2 S... [more]
CHS1_SINAL1.770e-9786.11Chalcone synthase 1 OS=Sinapis alba GN=CHS1 PE=2 S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H02EF DevOvary1 Citrus clementina cDNA clone C32001H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876218 ID=FC876218|Name=FC876218|organism=Citrus clementina|type=EST|length=675bp
GACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGTGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCGGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCT
back to top