FC876218

Overview
NameFC876218
Unique NameFC876218
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length675
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..681. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSY_VIGUN (Chalcone synthase OS=Vigna unguiculata GN=CHS PE=2 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 3.280e-99
Identity = 158/181 (87.29%), Postives = 172/181 (95.03%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V EIR AQRA+GPAT+LAIGTATP + V+Q+ YPDYYFRIT SEHMT+LKEKF+RMCDKSMIKKRYM++TEEILKENP+MCAYMAPSLDARQDIVVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVSEIRQAQRAEGPATILAIGTATPPNCVDQSTYPDYYFRITNSEHMTDLKEKFQRMCDKSMIKKRYMHVTEEILKENPSMCAYMAPSLDARQDIVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.6842 bits (130), Expect = 3.280e-99
Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEITAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS4_SORBI (Chalcone synthase 4 OS=Sorghum bicolor GN=CHS4 PE=3 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 4.278e-99
Identity = 160/179 (89.39%), Postives = 170/179 (94.97%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMTELKEKFKRMCDKS I+KRYM+LTEE L ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSVKR MMYQQGCFAGGTVLR+AKDLAENN
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTELKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENN 185          

HSP 2 Score: 51.6026 bits (122), Expect = 4.278e-99
Identity = 23/27 (85.19%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+++HLDS
Sbjct:  186 RGARVLVVCSEITAVTFRGPSESHLDS 212          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSB_PEA (Chalcone synthase 1B OS=Pisum sativum GN=CHS-1B PE=3 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 4.279e-99
Identity = 159/181 (87.85%), Postives = 171/181 (94.48%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV EIR AQ+A+GPATVLAIGTATP + V+Q+ YPDYYFRIT SEH TELKEKF+RMCDKSMIKKRYM+LTEEILKENP++C YMAPSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVTVDEIRQAQKAEGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKRYMHLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPHVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.6842 bits (130), Expect = 4.279e-99
Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEITAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSB_SOLTU (Chalcone synthase 1B OS=Solanum tuberosum GN=CHS1B PE=2 SV=1)

HSP 1 Score: 330.487 bits (846), Expect = 9.501e-99
Identity = 159/181 (87.85%), Postives = 170/181 (93.92%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV+E R AQRA+GPAT+LAIGT+TP++ V+Q+ YPDYYFRIT SEH TELKEKFKRMCDKSMIKKRYM+LTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPG DYQL KL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVTVEEYRKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGCDYQLAKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 51.6026 bits (122), Expect = 9.501e-99
Identity = 23/27 (85.19%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+++HLDS
Sbjct:  182 KGARVLVVCSEITAVTFRGPSESHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS2_SOLTU (Chalcone synthase 2 OS=Solanum tuberosum GN=CHS2 PE=2 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 9.501e-99
Identity = 157/181 (86.74%), Postives = 171/181 (94.48%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV+E+R AQRA GPAT++AIGTATP++ V+Q+ YPDYYFRIT SEHMTELKEKFKRMCDKSMI KRYM+LTEEILKENPN+C YMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTV+RLAKDLAENN
Sbjct:    1 MVTVEEVRKAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMINKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAENN 181          

HSP 2 Score: 52.373 bits (124), Expect = 9.501e-99
Identity = 24/27 (88.89%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTF GP+DTHLDS
Sbjct:  182 KGARVLVVCSEITAVTFSGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS1_HORVU (Chalcone synthase 1 OS=Hordeum vulgare GN=CHS1 PE=3 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 1.239e-98
Identity = 158/179 (88.27%), Postives = 172/179 (96.09%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            TV+E+RNAQRA+GPATVLAIGTATPA+ V QADYPDYYF+ITKS+HM +LKEKFKRMCDKS I+KRYM+LTEEIL+ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQP+SKITHL+FCTTSGVDMPGADYQLTK++GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    6 TVEEVRNAQRAEGPATVLAIGTATPANCVYQADYPDYYFKITKSDHMADLKEKFKRMCDKSQIRKRYMHLTEEILEENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPRSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 184          

HSP 2 Score: 50.447 bits (119), Expect = 1.239e-98
Identity = 23/27 (85.19%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP ++HLDS
Sbjct:  185 RGARVLVVCSEITAVTFRGPHESHLDS 211          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS1_GERHY (Chalcone synthase 1 OS=Gerbera hybrida GN=CHS1 PE=2 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 1.239e-98
Identity = 157/178 (88.20%), Postives = 170/178 (95.51%), Query Frame = 2
Query:   62 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            ++ IR+AQRA+GPAT+LAIGTATPA+ V QADYPDYYFRITKSEHM +LKEKFKRMCDKSMI+KRYM++TEE LK+NPNMCAYMAPSLD RQD+VVVEVPKLGKEAA KAIKEWG PKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    7 MKAIRDAQRAEGPATILAIGTATPANCVYQADYPDYYFRITKSEHMVDLKEKFKRMCDKSMIRKRYMHITEEYLKQNPNMCAYMAPSLDVRQDLVVVEVPKLGKEAAMKAIKEWGHPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 184          

HSP 2 Score: 53.5286 bits (127), Expect = 1.239e-98
Identity = 25/27 (92.59%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP DTHLDS
Sbjct:  185 KGARVLVVCSEITAVTFRGPNDTHLDS 211          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSE_IPOPU (Chalcone synthase E OS=Ipomoea purpurea GN=CHSE PE=2 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 1.240e-98
Identity = 156/181 (86.19%), Postives = 171/181 (94.48%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV+E+R AQRA GPAT++AIGT+TP + V+Q+ YPDYYFRIT SEH+ ELKEKFKRMC+KSMIKKRYMYLTEEIL ENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GL+PSVKRFMMYQQGCFAGGTV+RLAKDLAENN
Sbjct:    1 MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEKSMIKKRYMYLTEEILTENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENN 181          

HSP 2 Score: 52.7582 bits (125), Expect = 1.240e-98
Identity = 24/27 (88.89%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+D HLDS
Sbjct:  182 KGARVLVVCSEITAVTFRGPSDAHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSJ_PETHY (Chalcone synthase J OS=Petunia hybrida GN=CHSJ PE=2 SV=2)

HSP 1 Score: 328.176 bits (840), Expect = 1.240e-98
Identity = 158/181 (87.29%), Postives = 171/181 (94.48%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV+EIR AQRA+GPAT++AIGTATP++ V+Q+ YPDYYFRIT SEH TELKEKF+RMCDKSMIKKRYM+LTEEILKENPN+C YMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLR SVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVTVEEIRRAQRAEGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 53.5286 bits (127), Expect = 1.240e-98
Identity = 25/27 (92.59%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP DTHLDS
Sbjct:  182 KGARVLVVCSEITAVTFRGPNDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS6_SORBI (Chalcone synthase 6 OS=Sorghum bicolor GN=CHS6 PE=3 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 1.617e-98
Identity = 159/179 (88.83%), Postives = 169/179 (94.41%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMTELKEKFKRMCDKS I+KRYM+LTEE L ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSV R MMYQQGCFAGGTVLR+AKDLAENN
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTELKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENN 185          

HSP 2 Score: 51.6026 bits (122), Expect = 1.617e-98
Identity = 23/27 (85.19%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+++HLDS
Sbjct:  186 RGARVLVVCSEITAVTFRGPSESHLDS 212          
The following BLAST results are available for this feature:
BLAST of FC876218 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHSY_VIGUN3.280e-9987.29Chalcone synthase OS=Vigna unguiculata GN=CHS PE=2... [more]
CHS4_SORBI4.278e-9989.39Chalcone synthase 4 OS=Sorghum bicolor GN=CHS4 PE=... [more]
CHSB_PEA4.279e-9987.85Chalcone synthase 1B OS=Pisum sativum GN=CHS-1B PE... [more]
CHSB_SOLTU9.501e-9987.85Chalcone synthase 1B OS=Solanum tuberosum GN=CHS1B... [more]
CHS2_SOLTU9.501e-9986.74Chalcone synthase 2 OS=Solanum tuberosum GN=CHS2 P... [more]
CHS1_HORVU1.239e-9888.27Chalcone synthase 1 OS=Hordeum vulgare GN=CHS1 PE=... [more]
CHS1_GERHY1.239e-9888.20Chalcone synthase 1 OS=Gerbera hybrida GN=CHS1 PE=... [more]
CHSE_IPOPU1.240e-9886.19Chalcone synthase E OS=Ipomoea purpurea GN=CHSE PE... [more]
CHSJ_PETHY1.240e-9887.29Chalcone synthase J OS=Petunia hybrida GN=CHSJ PE=... [more]
CHS6_SORBI1.617e-9888.83Chalcone synthase 6 OS=Sorghum bicolor GN=CHS6 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H02EF DevOvary1 Citrus clementina cDNA clone C32001H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876218 ID=FC876218|Name=FC876218|organism=Citrus clementina|type=EST|length=675bp
GACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGTGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCGGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCT
back to top