FC876218

Overview
NameFC876218
Unique NameFC876218
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length675
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..681. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS2_SORBI (Chalcone synthase 2 OS=Sorghum bicolor GN=CHS2 PE=3 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 1.617e-98
Identity = 159/179 (88.83%), Postives = 169/179 (94.41%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMTELKEKFKRMCDKS I+KRYM+LTEE L ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSV R MMYQQGCFAGGTVLR+AKDLAENN
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTELKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENN 185          

HSP 2 Score: 51.6026 bits (122), Expect = 1.617e-98
Identity = 23/27 (85.19%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+++HLDS
Sbjct:  186 RGARVLVVCSEITAVTFRGPSESHLDS 212          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS1_SORBI (Chalcone synthase 1 OS=Sorghum bicolor GN=CHS1 PE=3 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 1.617e-98
Identity = 159/179 (88.83%), Postives = 169/179 (94.41%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMTELKEKFKRMCDKS I+KRYM+LTEE L ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSV R MMYQQGCFAGGTVLR+AKDLAENN
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTELKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENN 185          

HSP 2 Score: 51.6026 bits (122), Expect = 1.617e-98
Identity = 23/27 (85.19%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+++HLDS
Sbjct:  186 RGARVLVVCSEITAVTFRGPSESHLDS 212          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS5_SORBI (Chalcone synthase 5 OS=Sorghum bicolor GN=CHS5 PE=3 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 2.109e-98
Identity = 159/179 (88.83%), Postives = 169/179 (94.41%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMTELKEKFKRMCDKS I+KRYM+LTEE L ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSV R MMYQQGCFAGGTVLR+AKDLAENN
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTELKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAHKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENN 185          

HSP 2 Score: 51.6026 bits (122), Expect = 2.109e-98
Identity = 23/27 (85.19%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+++HLDS
Sbjct:  186 RGARVLVVCSEITAVTFRGPSESHLDS 212          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSY_CALCH (Chalcone synthase OS=Callistephus chinensis GN=CHS PE=2 SV=2)

HSP 1 Score: 327.02 bits (837), Expect = 2.752e-98
Identity = 157/178 (88.20%), Postives = 168/178 (94.38%), Query Frame = 2
Query:   62 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            +  IR AQR  GPAT+LAIGTATP++ V QADYPDYYFRITKSEHM +LKEKFKRMCDKSMI+KRYM+LTEE LKENP++C YMAPSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    7 IAAIREAQRRQGPATILAIGTATPSNCVYQADYPDYYFRITKSEHMVDLKEKFKRMCDKSMIRKRYMHLTEEYLKENPSLCEYMAPSLDARQDVVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 184          

HSP 2 Score: 53.5286 bits (127), Expect = 2.752e-98
Identity = 25/27 (92.59%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP DTHLDS
Sbjct:  185 KGARVLVVCSEITAVTFRGPNDTHLDS 211          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSA_SOLTU (Chalcone synthase 1A OS=Solanum tuberosum GN=CHS1A PE=2 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 2.752e-98
Identity = 158/181 (87.29%), Postives = 169/181 (93.37%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV+E R AQRA+GPAT+LAIGT+TP++ V+Q+ YPDYYFRIT SEH TELKEKFKRMCDKSMIKKRYM+LTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPG DYQL KL+GLRPSVKR MMYQQGCF GGTVLRLAKDLAENN
Sbjct:    1 MVTVEEYRKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGCDYQLAKLLGLRPSVKRLMMYQQGCFVGGTVLRLAKDLAENN 181          

HSP 2 Score: 51.6026 bits (122), Expect = 2.752e-98
Identity = 23/27 (85.19%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+++HLDS
Sbjct:  182 KGARVLVVCSEITAVTFRGPSESHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS3_SORBI (Chalcone synthase 3 OS=Sorghum bicolor GN=CHS3 PE=3 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 3.590e-98
Identity = 158/179 (88.27%), Postives = 169/179 (94.41%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMT+LKEKFKRMCDKS I+KRYM+LTEE L ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSV R MMYQQGCFAGGTVLR+AKDLAENN
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTDLKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENN 185          

HSP 2 Score: 51.6026 bits (122), Expect = 3.590e-98
Identity = 23/27 (85.19%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+++HLDS
Sbjct:  186 RGARVLVVCSEITAVTFRGPSESHLDS 212          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS7_SORBI (Chalcone synthase 7 OS=Sorghum bicolor GN=CHS7 PE=3 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 3.590e-98
Identity = 158/179 (88.27%), Postives = 169/179 (94.41%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMT+LKEKFKRMCDKS I+KRYM+LTEE L ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSV R MMYQQGCFAGGTVLR+AKDLAENN
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTDLKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENN 185          

HSP 2 Score: 51.6026 bits (122), Expect = 3.590e-98
Identity = 23/27 (85.19%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+++HLDS
Sbjct:  186 RGARVLVVCSEITAVTFRGPSESHLDS 212          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS7_PICMA (Chalcone synthase 7 OS=Picea mariana GN=CSF7 PE=2 SV=1)

HSP 1 Score: 325.094 bits (832), Expect = 4.684e-98
Identity = 155/181 (85.64%), Postives = 171/181 (94.48%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            MA ++  R AQRADGPAT+LAIGTATP ++V+Q+ YPDYYF+IT SEHMTELKEKF+RMCDKS IKKRYMYLT+EILKENPN+C YMAPSLDARQD+VVVEVP+LGKEAATKAIKEWGQPKSKITH+IFCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLR+AKDLAENN
Sbjct:    6 MADLEAFRKAQRADGPATILAIGTATPPNAVDQSTYPDYYFKITNSEHMTELKEKFQRMCDKSAIKKRYMYLTDEILKENPNVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHVIFCTTSGVDMPGADYQLTKLLGLRPSVKRVMMYQQGCFAGGTVLRVAKDLAENN 186          

HSP 2 Score: 54.6842 bits (130), Expect = 4.684e-98
Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+DTHLDS
Sbjct:  187 RGARVLVVCSEITAVTFRGPSDTHLDS 213          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSA_PETHY (Chalcone synthase A OS=Petunia hybrida GN=CHSA PE=2 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 4.685e-98
Identity = 157/181 (86.74%), Postives = 169/181 (93.37%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV+E R AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEH T+LKEKFKRMC+KSMIKKRYM+LTEEILKENP+MC YMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPG DYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVTVEEYRKAQRAEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMCEKSMIKKRYMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 53.5286 bits (127), Expect = 4.685e-98
Identity = 25/27 (92.59%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP DTHLDS
Sbjct:  182 KGARVLVVCSEITAVTFRGPNDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSA_PEA (Chalcone synthase 1A OS=Pisum sativum GN=CHS-1A PE=3 SV=1)

HSP 1 Score: 325.094 bits (832), Expect = 4.685e-98
Identity = 157/181 (86.74%), Postives = 169/181 (93.37%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV EIR AQRA+GPATV AIGTATP + V Q+ YPD+YFRIT S+H TELKEKF+RMCDKSMIKKRYM+LTEEILKENP++C YMAPSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVTVNEIRQAQRAEGPATVFAIGTATPQNCVEQSTYPDFYFRITNSQHKTELKEKFQRMCDKSMIKKRYMHLTEEILKENPSLCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.6842 bits (130), Expect = 4.685e-98
Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEITAVTFRGPSDTHLDS 208          
The following BLAST results are available for this feature:
BLAST of FC876218 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHS2_SORBI1.617e-9888.83Chalcone synthase 2 OS=Sorghum bicolor GN=CHS2 PE=... [more]
CHS1_SORBI1.617e-9888.83Chalcone synthase 1 OS=Sorghum bicolor GN=CHS1 PE=... [more]
CHS5_SORBI2.109e-9888.83Chalcone synthase 5 OS=Sorghum bicolor GN=CHS5 PE=... [more]
CHSY_CALCH2.752e-9888.20Chalcone synthase OS=Callistephus chinensis GN=CHS... [more]
CHSA_SOLTU2.752e-9887.29Chalcone synthase 1A OS=Solanum tuberosum GN=CHS1A... [more]
CHS3_SORBI3.590e-9888.27Chalcone synthase 3 OS=Sorghum bicolor GN=CHS3 PE=... [more]
CHS7_SORBI3.590e-9888.27Chalcone synthase 7 OS=Sorghum bicolor GN=CHS7 PE=... [more]
CHS7_PICMA4.684e-9885.64Chalcone synthase 7 OS=Picea mariana GN=CSF7 PE=2 ... [more]
CHSA_PETHY4.685e-9886.74Chalcone synthase A OS=Petunia hybrida GN=CHSA PE=... [more]
CHSA_PEA4.685e-9886.74Chalcone synthase 1A OS=Pisum sativum GN=CHS-1A PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H02EF DevOvary1 Citrus clementina cDNA clone C32001H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876218 ID=FC876218|Name=FC876218|organism=Citrus clementina|type=EST|length=675bp
GACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGTGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCGGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCT
back to top