FC876218

Overview
NameFC876218
Unique NameFC876218
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length675
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..681. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS2_MEDSA (Chalcone synthase 2 OS=Medicago sativa GN=CHS2 PE=1 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 8.729e-97
Identity = 154/181 (85.08%), Postives = 168/181 (92.82%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V EIR AQRA+GPAT+LAIGTA PA+ V Q+ YPD+YF+IT SEH TELKEKF+RMCDKSMIK+RYMYLTEEILKENPN+C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLI CTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPANCVEQSTYPDFYFKITNSEHKTELKEKFQRMCDKSMIKRRYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIVCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.299 bits (129), Expect = 8.729e-97
Identity = 24/27 (88.89%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSE+TAVTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSY_ORYSJ (Chalcone synthase OS=Oryza sativa subsp. japonica GN=CHS PE=2 SV=1)

HSP 1 Score: 325.094 bits (832), Expect = 1.139e-96
Identity = 155/179 (86.59%), Postives = 169/179 (94.41%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            TV+E+R AQRA+GPATVLAIGTATPA+ V QADYPDYYFRITKSEHM ELKEKFKRMCDKS I+KRYM+LTEEIL+ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQP+S+ITHL+FCTTSGVDMPGADYQL K++GLRP+V R MMYQQGCFAGGTVLR+AKDLAENN
Sbjct:    6 TVEEVRRAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITKSEHMVELKEKFKRMCDKSQIRKRYMHLTEEILQENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPRSRITHLVFCTTSGVDMPGADYQLAKMLGLRPNVNRLMMYQQGCFAGGTVLRVAKDLAENN 184          

HSP 2 Score: 50.0618 bits (118), Expect = 1.139e-96
Identity = 22/27 (81.48%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVL VCSEITAVTFRGP+++HLDS
Sbjct:  185 RGARVLAVCSEITAVTFRGPSESHLDS 211          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSY_ORYSI (Chalcone synthase OS=Oryza sativa subsp. indica GN=CHS PE=2 SV=1)

HSP 1 Score: 325.094 bits (832), Expect = 1.139e-96
Identity = 155/179 (86.59%), Postives = 169/179 (94.41%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            TV+E+R AQRA+GPATVLAIGTATPA+ V QADYPDYYFRITKSEHM ELKEKFKRMCDKS I+KRYM+LTEEIL+ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQP+S+ITHL+FCTTSGVDMPGADYQL K++GLRP+V R MMYQQGCFAGGTVLR+AKDLAENN
Sbjct:    6 TVEEVRRAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITKSEHMVELKEKFKRMCDKSQIRKRYMHLTEEILQENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPRSRITHLVFCTTSGVDMPGADYQLAKMLGLRPNVSRLMMYQQGCFAGGTVLRVAKDLAENN 184          

HSP 2 Score: 50.0618 bits (118), Expect = 1.139e-96
Identity = 22/27 (81.48%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVL VCSEITAVTFRGP+++HLDS
Sbjct:  185 RGARVLAVCSEITAVTFRGPSESHLDS 211          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS4_TRISU (Chalcone synthase 4 (Fragment) OS=Trifolium subterraneum GN=CHS4 PE=2 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 1.140e-96
Identity = 154/181 (85.08%), Postives = 167/181 (92.27%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V EIR AQRA+GPAT+LAIGTA PA+ V QA YPD+YF+IT SEH  ELKEKF+RMCDKSMIK RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPANKVEQATYPDFYFKITNSEHKVELKEKFQRMCDKSMIKSRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.299 bits (129), Expect = 1.140e-96
Identity = 24/27 (88.89%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSE+TAVTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS1_IPOBA (Chalcone synthase LF1 OS=Ipomoea batatas GN=CHS-LF1 PE=2 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 1.486e-96
Identity = 154/181 (85.08%), Postives = 167/181 (92.27%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV+E+R AQRA+GPAT+LAIGT TPA+ VNQ+ YPDYYFRIT SEH TELKEKF+RMCDKSMI KRYM+LTEEILKENP+ C YMAPSLDARQDI VVEVPKLGKEAA  AIKEWGQPKSKITH++FCTTSG+DMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSGIDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 51.2174 bits (121), Expect = 1.486e-96
Identity = 22/27 (81.48%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVL+VCSEIT VTFRGP++THLDS
Sbjct:  182 KGARVLIVCSEITVVTFRGPSETHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSY_CATRO (Chalcone synthase OS=Catharanthus roseus GN=CHS PE=2 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 1.486e-96
Identity = 157/181 (86.74%), Postives = 170/181 (93.92%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M  V+EIRNAQRA GPATVLAIGT+TP++ V+Q+ YPDYYFRIT SEH TELKEKFKRMC+KSMIKKRYM+LTEEIL+ENPN+CAYMAPSLDARQ+IVVVEVPKLGKEAA KAIKEWGQ KSKITHL+FCTTSGVDMPGADYQLTKL+GLR SVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVNVEEIRNAQRAQGPATVLAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKKRYMHLTEEILQENPNICAYMAPSLDARQNIVVVEVPKLGKEAAQKAIKEWGQSKSKITHLVFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 51.6026 bits (122), Expect = 1.486e-96
Identity = 23/27 (85.19%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+++HLDS
Sbjct:  182 KGARVLVVCSEITAVTFRGPSESHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS5_TRISU (Chalcone synthase 5 OS=Trifolium subterraneum GN=CHS5 PE=2 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 1.486e-96
Identity = 154/181 (85.08%), Postives = 167/181 (92.27%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V EIR AQRA+GPAT+LAIGTA PA+ V QA YPD+YF+IT SEH  ELKEKF+RMCDKSMIK RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVAEIRQAQRAEGPATILAIGTANPANKVEQATYPDFYFKITNSEHKVELKEKFQRMCDKSMIKSRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.299 bits (129), Expect = 1.486e-96
Identity = 24/27 (88.89%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSE+TAVTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS2_TRISU (Chalcone synthase 2 OS=Trifolium subterraneum GN=CHS2 PE=3 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 1.486e-96
Identity = 154/181 (85.08%), Postives = 167/181 (92.27%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V EIR AQRA+GPAT+LAIGTA PA+ V QA YPD+YF+IT SEH  ELKEKF+RMCDKSMIK RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPANRVEQATYPDFYFKITNSEHKVELKEKFQRMCDKSMIKSRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.299 bits (129), Expect = 1.486e-96
Identity = 24/27 (88.89%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSE+TAVTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS8_IPOBA (Chalcone synthase DIV OS=Ipomoea batatas GN=CHS-DIV PE=2 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 1.486e-96
Identity = 154/181 (85.08%), Postives = 167/181 (92.27%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV+E+R AQRA+GPAT+LAIGT TPA+ VNQ+ YPDYYFRIT SEH TELKEKF+RMCDKSMI KRYM+LTEEILKENP+ C YMAPSLDARQDI VVEVPKLGKEAA  AIKEWGQPKSKITH++FCTTSG+DMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSGIDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 51.2174 bits (121), Expect = 1.486e-96
Identity = 22/27 (81.48%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVL+VCSEIT VTFRGP++THLDS
Sbjct:  182 KGARVLIVCSEITVVTFRGPSETHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS8_BROFI (Chalcone synthase 8 OS=Bromheadia finlaysoniana GN=CHS8 PE=2 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 1.938e-96
Identity = 153/178 (85.96%), Postives = 169/178 (94.94%), Query Frame = 2
Query:   62 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            ++EIR AQRA+GPA VLAIGT+TP +++ QADYPDYYFRITKSEH+TELKEKFKRMCDKSMIKKRYMYLTEEILKENPN+CA+MAPSLDARQDIVV EVPKL KEAA +AIKEWG PKS+ITHLIFCTTSG+DMPGADYQLT+L+GLRPSV RFM+YQQGCFAGGTVLRLAKDLAENN
Sbjct:    5 MEEIRQAQRAEGPAAVLAIGTSTPPNALYQADYPDYYFRITKSEHLTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNICAFMAPSLDARQDIVVTEVPKLAKEAAARAIKEWGHPKSRITHLIFCTTSGIDMPGADYQLTRLLGLRPSVNRFMLYQQGCFAGGTVLRLAKDLAENN 182          

HSP 2 Score: 51.2174 bits (121), Expect = 1.938e-96
Identity = 23/26 (88.46%), Postives = 26/26 (100.00%), Query Frame = 1
Query:  598 GARVLVVCSEITAVTFRGPADTHLDS 675
            GARVLVVCSEITAVTFRGP+++HLDS
Sbjct:  184 GARVLVVCSEITAVTFRGPSESHLDS 209          
The following BLAST results are available for this feature:
BLAST of FC876218 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHS2_MEDSA8.729e-9785.08Chalcone synthase 2 OS=Medicago sativa GN=CHS2 PE=... [more]
CHSY_ORYSJ1.139e-9686.59Chalcone synthase OS=Oryza sativa subsp. japonica ... [more]
CHSY_ORYSI1.139e-9686.59Chalcone synthase OS=Oryza sativa subsp. indica GN... [more]
CHS4_TRISU1.140e-9685.08Chalcone synthase 4 (Fragment) OS=Trifolium subter... [more]
CHS1_IPOBA1.486e-9685.08Chalcone synthase LF1 OS=Ipomoea batatas GN=CHS-LF... [more]
CHSY_CATRO1.486e-9686.74Chalcone synthase OS=Catharanthus roseus GN=CHS PE... [more]
CHS5_TRISU1.486e-9685.08Chalcone synthase 5 OS=Trifolium subterraneum GN=C... [more]
CHS2_TRISU1.486e-9685.08Chalcone synthase 2 OS=Trifolium subterraneum GN=C... [more]
CHS8_IPOBA1.486e-9685.08Chalcone synthase DIV OS=Ipomoea batatas GN=CHS-DI... [more]
CHS8_BROFI1.938e-9685.96Chalcone synthase 8 OS=Bromheadia finlaysoniana GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H02EF DevOvary1 Citrus clementina cDNA clone C32001H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876218 ID=FC876218|Name=FC876218|organism=Citrus clementina|type=EST|length=675bp
GACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGTGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCGGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCT
back to top