FC876218

Overview
NameFC876218
Unique NameFC876218
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length675
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..681. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSY_ANTMA (Chalcone synthase OS=Antirrhinum majus GN=CHS PE=3 SV=1)

HSP 1 Score: 332.028 bits (850), Expect = 2.296e-100
Identity = 160/181 (88.40%), Postives = 172/181 (95.03%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV+E+R AQRA+GPATVLAIGTATPA+ V+Q+ YPDYYFRIT SEHMTELKEKFKRMCDKS IK+RYM+LTEEILKENP MC YMAPSLDARQDIVVVEVP+LGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLR+AKDLAENN
Sbjct:    1 MVTVEEVRRAQRAEGPATVLAIGTATPANCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSNIKRRYMHLTEEILKENPAMCEYMAPSLDARQDIVVVEVPRLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENN 181          

HSP 2 Score: 55.4546 bits (132), Expect = 2.296e-100
Identity = 26/26 (100.00%), Postives = 26/26 (100.00%), Query Frame = 1
Query:  598 GARVLVVCSEITAVTFRGPADTHLDS 675
            GARVLVVCSEITAVTFRGPADTHLDS
Sbjct:  183 GARVLVVCSEITAVTFRGPADTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSY_VITVI (Chalcone synthase OS=Vitis vinifera GN=CHS PE=2 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 2.995e-100
Identity = 162/181 (89.50%), Postives = 172/181 (95.03%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V EIR AQRA+GPATVLAIGTATPA+ V QADYPDYYFRIT SEHMTELKEKFKRMC+KSMI KRYM+LTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GL+PSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVAEIRKAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMCEKSMINKRYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 53.1434 bits (126), Expect = 2.995e-100
Identity = 24/26 (92.31%), Postives = 26/26 (100.00%), Query Frame = 1
Query:  598 GARVLVVCSEITAVTFRGPADTHLDS 675
            G+RVLVVCSEITAVTFRGP+DTHLDS
Sbjct:  183 GSRVLVVCSEITAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSY_PUELO (Chalcone synthase OS=Pueraria lobata GN=CHS PE=2 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 2.995e-100
Identity = 161/181 (88.95%), Postives = 171/181 (94.48%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V EIR AQRA+GPAT+LAIGTA P + V+Q+ YPDYYFRIT SEHMTELKEKF+RMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTK +GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVAEIRQAQRAEGPATILAIGTANPPNCVDQSTYPDYYFRITNSEHMTELKEKFQRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKQLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.6842 bits (130), Expect = 2.995e-100
Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEITAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS1_CASGL (Chalcone synthase OS=Casuarina glauca GN=CHS1 PE=2 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 2.995e-100
Identity = 159/181 (87.85%), Postives = 172/181 (95.03%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV+E+R AQRA+GPATVLAIGTATP + ++Q+ YPDYYFRIT SEH TELKEKF+RMCDKSMIKKRYMYLTEEILKE+PNMCAYMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVTVEEVRKAQRAEGPATVLAIGTATPPNCLDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKRYMYLTEEILKEHPNMCAYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.6842 bits (130), Expect = 2.995e-100
Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+DTHLDS
Sbjct:  182 RGARVLVVCSEITAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSY_PHAVU (Chalcone synthase 17 OS=Phaseolus vulgaris GN=CHS17 PE=2 SV=1)

HSP 1 Score: 332.028 bits (850), Expect = 3.907e-100
Identity = 160/181 (88.40%), Postives = 172/181 (95.03%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V EIR AQRA+GPAT+LAIGTATP++ V+Q+ YPDYYFRIT SEHMT+LKEKF+RMCDKSMIKKRYM+L EEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVSEIRQAQRAEGPATILAIGTATPSNCVDQSTYPDYYFRITNSEHMTDLKEKFQRMCDKSMIKKRYMHLNEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.6842 bits (130), Expect = 3.907e-100
Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEITAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS6_SOYBN (Chalcone synthase 6 OS=Glycine max GN=CHS6 PE=3 SV=1)

HSP 1 Score: 330.872 bits (847), Expect = 1.132e-99
Identity = 159/181 (87.85%), Postives = 172/181 (95.03%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V+EIR AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT S+HM ELKEKFKRMCDKSMIKKRYMYL EEILKENP++CAYM PSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSDHMNELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVCAYMEPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.299 bits (129), Expect = 1.132e-99
Identity = 25/26 (96.15%), Postives = 26/26 (100.00%), Query Frame = 1
Query:  598 GARVLVVCSEITAVTFRGPADTHLDS 675
            GARVLVVCSEITAVTFRGP+DTHLDS
Sbjct:  183 GARVLVVCSEITAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS1_CAMSI (Chalcone synthase 1 OS=Camellia sinensis GN=CHS1 PE=2 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 1.477e-99
Identity = 159/181 (87.85%), Postives = 170/181 (93.92%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV++IR AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEH  ELKEKFKRMCDKSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVTVEDIRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCDKSMIKKRYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.6842 bits (130), Expect = 1.477e-99
Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEITAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS2_SOLLC (Chalcone synthase 2 OS=Solanum lycopersicum GN=CHS2 PE=2 SV=2)

HSP 1 Score: 329.717 bits (844), Expect = 1.927e-99
Identity = 157/181 (86.74%), Postives = 171/181 (94.48%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV+E+R AQRA GPAT++AIGTATP++ V+Q+ YPDYYFRIT SEHMTELKEKFKRMCDKSMI KRYM+LTEEILKENPN+C YMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTV+RLAKDLAENN
Sbjct:    1 MVTVEEVRRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMINKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAENN 181          

HSP 2 Score: 54.6842 bits (130), Expect = 1.927e-99
Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEITAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSE_IPONI (Chalcone synthase E OS=Ipomoea nil GN=CHSE PE=2 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 2.514e-99
Identity = 157/181 (86.74%), Postives = 172/181 (95.03%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV+E+R AQRA GPAT++AIGT+TP + V+Q+ YPDYYFRIT SEH+ ELKEKFKRMC+KSMIKKRYMYLTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GL+PSVKRFMMYQQGCFAGGTV+RLAKDLAENN
Sbjct:    1 MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENN 181          

HSP 2 Score: 52.7582 bits (125), Expect = 2.514e-99
Identity = 24/27 (88.89%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+D HLDS
Sbjct:  182 KGARVLVVCSEITAVTFRGPSDAHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSY_HYPAN (Chalcone synthase OS=Hypericum androsaemum PE=1 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 3.280e-99
Identity = 158/181 (87.29%), Postives = 168/181 (92.82%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV+E+R AQRA+GPATV+AIGTA P + V+QA YPDYYFRIT SEH  ELKEKF+RMCDKS IKKRYMYL EE+LKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVTVEEVRKAQRAEGPATVMAIGTAVPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSQIKKRYMYLNEEVLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.299 bits (129), Expect = 3.280e-99
Identity = 25/27 (92.59%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP DTHLDS
Sbjct:  182 KGARVLVVCSEITAVTFRGPTDTHLDS 208          
The following BLAST results are available for this feature:
BLAST of FC876218 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHSY_ANTMA2.296e-10088.40Chalcone synthase OS=Antirrhinum majus GN=CHS PE=3... [more]
CHSY_VITVI2.995e-10089.50Chalcone synthase OS=Vitis vinifera GN=CHS PE=2 SV... [more]
CHSY_PUELO2.995e-10088.95Chalcone synthase OS=Pueraria lobata GN=CHS PE=2 S... [more]
CHS1_CASGL2.995e-10087.85Chalcone synthase OS=Casuarina glauca GN=CHS1 PE=2... [more]
CHSY_PHAVU3.907e-10088.40Chalcone synthase 17 OS=Phaseolus vulgaris GN=CHS1... [more]
CHS6_SOYBN1.132e-9987.85Chalcone synthase 6 OS=Glycine max GN=CHS6 PE=3 SV... [more]
CHS1_CAMSI1.477e-9987.85Chalcone synthase 1 OS=Camellia sinensis GN=CHS1 P... [more]
CHS2_SOLLC1.927e-9986.74Chalcone synthase 2 OS=Solanum lycopersicum GN=CHS... [more]
CHSE_IPONI2.514e-9986.74Chalcone synthase E OS=Ipomoea nil GN=CHSE PE=2 SV... [more]
CHSY_HYPAN3.280e-9987.29Chalcone synthase OS=Hypericum androsaemum PE=1 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H02EF DevOvary1 Citrus clementina cDNA clone C32001H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876218 ID=FC876218|Name=FC876218|organism=Citrus clementina|type=EST|length=675bp
GACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGTGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCGGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCT
back to top