FC876218

Overview
NameFC876218
Unique NameFC876218
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length675
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..681. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: THS1_VITVI (Stilbene synthase 1 OS=Vitis vinifera GN=VINST1 PE=1 SV=2)

HSP 1 Score: 290.426 bits (742), Expect = 8.864e-85
Identity = 135/181 (74.59%), Postives = 162/181 (89.50%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            MA+V+E RNAQRA GPAT+LAIGTATP H V Q+DY DYYFR+TKSEHMTELK+KF R+CDKSMIKKRY++LTEE+L+E+PN+ AYMAPSL+ RQ+I+  EVP+LG++AA KA+KEWGQPKSKITHL+FCTTSGV+MPGADY+L  L+GL  SV+R M+Y QGC+AGGTVLR AKDLAENN
Sbjct:    1 MASVEEFRNAQRAKGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLTEEMLEEHPNIGAYMAPSLNIRQEIITAEVPRLGRDAALKALKEWGQPKSKITHLVFCTTSGVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENN 181          

HSP 2 Score: 45.0542 bits (105), Expect = 8.864e-85
Identity = 21/26 (80.77%), Postives = 23/26 (88.46%), Query Frame = 1
Query:  598 GARVLVVCSEITAVTFRGPADTHLDS 675
            GARVLVVCSEIT VTFRGP++  LDS
Sbjct:  183 GARVLVVCSEITVVTFRGPSEDALDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: THS3_VITVI (Stilbene synthase 3 (Fragment) OS=Vitis vinifera PE=2 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 1.649e-83
Identity = 135/178 (75.84%), Postives = 159/178 (89.33%), Query Frame = 2
Query:   62 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            V+EIRNAQRA GPAT+LAIGTATP H V Q+DY DYYFR+TKSE M+ELK+KF R+CDKSMIKKRY++LTEE+L+E+PN+ AYMAPSL+ RQ+I+  EVPKLGKEAA KA+KEWGQPKSKITHL+FCTTSGV+MPGADY+L  L+GL  SV+R M+Y QGC+AGGTVLR AKDLAENN
Sbjct:    1 VEEIRNAQRAKGPATILAIGTATPDHCVYQSDYADYYFRVTKSEPMSELKKKFNRICDKSMIKKRYIHLTEEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTSGVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENN 178          

HSP 2 Score: 45.0542 bits (105), Expect = 1.649e-83
Identity = 21/26 (80.77%), Postives = 23/26 (88.46%), Query Frame = 1
Query:  598 GARVLVVCSEITAVTFRGPADTHLDS 675
            GARVLVVCSEIT VTFRGP++  LDS
Sbjct:  180 GARVLVVCSEITVVTFRGPSEDALDS 205          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS2_HORVU (Chalcone synthase 2 OS=Hordeum vulgare GN=CHS2 PE=2 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 3.659e-83
Identity = 136/178 (76.40%), Postives = 157/178 (88.20%), Query Frame = 2
Query:   62 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            ++E+R AQRA+G ATVLAIGTA PA+ V QA YPDYYFR+TKSEH+ +LKEKF+RMCDKSMI+KR+M+LTEEIL +NP +CA+M  SLDAR  I +VEVPKLG+ AA KAIKEWGQP SKITHL+FCTTSGVDMPGADYQLTKL+GL P+VKR MMYQQGCF G TVLRLAKD+AENN
Sbjct:    6 LKEVRMAQRAEGLATVLAIGTAVPANCVYQATYPDYYFRVTKSEHLADLKEKFQRMCDKSMIRKRHMHLTEEILIKNPKICAHMETSLDARHAIALVEVPKLGQGAAEKAIKEWGQPLSKITHLVFCTTSGVDMPGADYQLTKLLGLSPTVKRLMMYQQGCFGGATVLRLAKDIAENN 183          

HSP 2 Score: 46.9802 bits (110), Expect = 3.659e-83
Identity = 21/27 (77.78%), Postives = 24/27 (88.89%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITA+ FRGP  +HLDS
Sbjct:  184 RGARVLVVCSEITAMAFRGPCKSHLDS 210          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: THS3_ARAHY (Stilbene synthase 3 OS=Arachis hypogaea PE=2 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 1.382e-82
Identity = 133/181 (73.48%), Postives = 158/181 (87.29%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V  IR  QRA+GPATVLAIGTA P + ++Q+ Y DYYFR+T SEHMT+LK+KF+R+C+++ IK R+MYLTEEILKENPNMCAY APSLDAR+D+++ EVP++GKEAATKAIKEWGQP SKITHLIFCTTSGV +PG DY+L  L+GL P VKR+MMY QGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVSGIRKVQRAEGPATVLAIGTANPPNCIDQSTYADYYFRVTNSEHMTDLKKKFQRICERTQIKNRHMYLTEEILKENPNMCAYKAPSLDAREDMMIREVPRVGKEAATKAIKEWGQPMSKITHLIFCTTSGVALPGVDYELIVLLGLDPCVKRYMMYHQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 43.1282 bits (100), Expect = 1.382e-82
Identity = 19/25 (76.00%), Postives = 23/25 (92.00%), Query Frame = 1
Query:  601 ARVLVVCSEITAVTFRGPADTHLDS 675
            ARVL+VCSE TAVTFRGP++T +DS
Sbjct:  184 ARVLIVCSENTAVTFRGPSETDMDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: THS1_ARAHY (Stilbene synthase 1 OS=Arachis hypogaea PE=2 SV=1)

HSP 1 Score: 285.804 bits (730), Expect = 1.802e-82
Identity = 134/181 (74.03%), Postives = 158/181 (87.29%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V  IR  QRA+GPATVLAIGTA P + V+Q+ Y DYYFR+T  EHMT+LK+KF+R+C+++ IK R+MYLTEEILKENPNMCAY APSLDAR+D+++ EVP++GKEAATKAIKEWGQP SKITHLIFCTTSGV +PG DY+L  L+GL PSVKR+MMY QGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVSGIRKVQRAEGPATVLAIGTANPPNCVDQSTYADYYFRVTNGEHMTDLKKKFQRICERTQIKNRHMYLTEEILKENPNMCAYKAPSLDAREDMMIREVPRVGKEAATKAIKEWGQPMSKITHLIFCTTSGVALPGVDYELIVLLGLDPSVKRYMMYHQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 41.9726 bits (97), Expect = 1.802e-82
Identity = 19/25 (76.00%), Postives = 22/25 (88.00%), Query Frame = 1
Query:  601 ARVLVVCSEITAVTFRGPADTHLDS 675
            ARVL+VCSE TAVTFRGP +T +DS
Sbjct:  184 ARVLIVCSENTAVTFRGPNETDMDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: 2PS_GERHY (2-pyrone synthase OS=Gerbera hybrida GN=2PS PE=1 SV=2)

HSP 1 Score: 281.182 bits (718), Expect = 1.158e-81
Identity = 136/178 (76.40%), Postives = 154/178 (86.52%), Query Frame = 2
Query:   62 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            V+ IR A RA G AT+LAIGTATP + V QADY DYYFR+TKSEHM +LKEKFKR+C+K+ IKKRY+ LTE+ L+ENP MC +MAPSL+ARQD+VV  VP LGKEAA KAI EWG PKSKITHLIFCTT+GVDMPGADYQL KL+GL PSVKR+M+YQQGC AGGTVLRLAKDLAENN
Sbjct:    9 VEVIREAGRAQGLATILAIGTATPPNCVAQADYADYYFRVTKSEHMVDLKEKFKRICEKTAIKKRYLALTEDYLQENPTMCEFMAPSLNARQDLVVTGVPMLGKEAAVKAIDEWGLPKSKITHLIFCTTAGVDMPGADYQLVKLLGLSPSVKRYMLYQQGCAAGGTVLRLAKDLAENN 186          

HSP 2 Score: 43.8986 bits (102), Expect = 1.158e-81
Identity = 18/27 (66.67%), Postives = 23/27 (85.19%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +G+RVL+VCSEITA+ F GP + HLDS
Sbjct:  187 KGSRVLIVCSEITAILFHGPNENHLDS 213          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: ACS2_RUTGR (Acridone synthase 2 OS=Ruta graveolens GN=ACS2 PE=1 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 3.662e-80
Identity = 129/181 (71.27%), Postives = 158/181 (87.29%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +++E+R AQ+++GPA +LAIGTATP +   QADYPDYYF+ITKSEHMTELK+KFK +C+KSMI+KR+M  ++E LK NP +C +M  SL+ARQDI VVE P++GKEAA KAIKEWG PKS ITHLIFCT++GVDMPGADYQLT+++GL PSVKR M+YQQGC+AGGTVLRLAKDLAENN
Sbjct:    1 MESLKEMRKAQKSEGPAAILAIGTATPDNVYIQADYPDYYFKITKSEHMTELKDKFKTLCEKSMIRKRHMCFSQEFLKANPEVCKHMGKSLNARQDIAVVETPRIGKEAAVKAIKEWGHPKSSITHLIFCTSAGVDMPGADYQLTRMLGLNPSVKRMMIYQQGCYAGGTVLRLAKDLAENN 181          

HSP 2 Score: 40.4318 bits (93), Expect = 3.662e-80
Identity = 18/27 (66.67%), Postives = 23/27 (85.19%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +G+RVLVVCSE+TA TFRGP+   +DS
Sbjct:  182 KGSRVLVVCSELTAPTFRGPSPDAVDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSG_PETHY (Chalcone synthase G OS=Petunia hybrida GN=CHSG PE=2 SV=2)

HSP 1 Score: 283.108 bits (723), Expect = 8.879e-79
Identity = 135/181 (74.59%), Postives = 157/181 (86.74%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            MATV+EIR AQRA+GPATVLAIGTA P++ V+Q+ YPD+ FRIT S+H TELKEKFK MC+ SMIKKRY++LTEEILK NPN+C + APSL+ARQ+I V E PKLGK AA KAI+EW Q KSKITHL+FCTT+ V++PGADYQLTKL+GL PSVKR MMYQQGC+ GGT LRLAKDLAENN
Sbjct:    1 MATVEEIRKAQRAEGPATVLAIGTANPSNCVDQSAYPDFLFRITTSDHKTELKEKFKHMCEGSMIKKRYLHLTEEILKNNPNICEHKAPSLNARQEIAVAEAPKLGKRAAQKAIEEWSQSKSKITHLVFCTTTSVELPGADYQLTKLLGLSPSVKRSMMYQQGCYGGGTALRLAKDLAENN 181          

HSP 2 Score: 32.3426 bits (72), Expect = 8.879e-79
Identity = 14/26 (53.85%), Postives = 19/26 (73.08%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLD 672
            +GARVLVVC EIT ++F+ P+    D
Sbjct:  182 KGARVLVVCVEITVMSFQAPSRNDTD 207          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: ACS3_RUTGR (Probable acridone synthase 3 OS=Ruta graveolens GN=ACS3 PE=2 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 8.879e-79
Identity = 127/181 (70.17%), Postives = 156/181 (86.19%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +++E+R AQ ++GPA +LAIGTA P +   QADYPDYYF++TKSEHMTELK+KF+ +C+KSMI+KR+M  +EE LK NP +C +M  SL+ARQDI VVE P+LG EAA KAIKEWGQPKS ITHLIFC+++GVDMPGADYQLT+++GL PSVKR M+YQQGC+AGGTVLRLAKDLAENN
Sbjct:    1 MESLKEMRKAQMSEGPAAILAIGTANPDNVYMQADYPDYYFKMTKSEHMTELKDKFRTLCEKSMIRKRHMCFSEEFLKANPEVCKHMGKSLNARQDIAVVETPRLGNEAAVKAIKEWGQPKSSITHLIFCSSAGVDMPGADYQLTRILGLNPSVKRMMIYQQGCYAGGTVLRLAKDLAENN 181          

HSP 2 Score: 40.4318 bits (93), Expect = 8.879e-79
Identity = 18/27 (66.67%), Postives = 23/27 (85.19%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +G+RVLVVCSE+TA TFRGP+   +DS
Sbjct:  182 KGSRVLVVCSELTAPTFRGPSPDAVDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: ACS4_RUTGR (Probable acridone synthase 4 OS=Ruta graveolens GN=ACS4 PE=2 SV=1)

HSP 1 Score: 274.248 bits (700), Expect = 1.511e-78
Identity = 128/181 (70.72%), Postives = 156/181 (86.19%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +++E+R AQ ++GPA +LAIGTATP +   QADYPDYYFR+TKSEHMTELK+KF+ +C+KSMI+KR+M  +EE LK NP +  +M  SL+ARQDI VVE P+LG EAA KAIKEWGQPKS ITHLIFC+++GVDMPGADYQLT+++GL PSVKR M+YQQGC+AGGTVLRLAKDLAENN
Sbjct:    1 MESLKEMRKAQMSEGPAAILAIGTATPNNVYMQADYPDYYFRMTKSEHMTELKDKFRTLCEKSMIRKRHMCFSEEFLKANPEVSKHMGKSLNARQDIAVVETPRLGNEAAVKAIKEWGQPKSSITHLIFCSSAGVDMPGADYQLTRILGLNPSVKRMMVYQQGCYAGGTVLRLAKDLAENN 181          

HSP 2 Score: 40.4318 bits (93), Expect = 1.511e-78
Identity = 18/27 (66.67%), Postives = 23/27 (85.19%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +G+RVLVVCSE+TA TFRGP+   +DS
Sbjct:  182 KGSRVLVVCSELTAPTFRGPSPDAVDS 208          
The following BLAST results are available for this feature:
BLAST of FC876218 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
THS1_VITVI8.864e-8574.59Stilbene synthase 1 OS=Vitis vinifera GN=VINST1 PE... [more]
THS3_VITVI1.649e-8375.84Stilbene synthase 3 (Fragment) OS=Vitis vinifera P... [more]
CHS2_HORVU3.659e-8376.40Chalcone synthase 2 OS=Hordeum vulgare GN=CHS2 PE=... [more]
THS3_ARAHY1.382e-8273.48Stilbene synthase 3 OS=Arachis hypogaea PE=2 SV=1[more]
THS1_ARAHY1.802e-8274.03Stilbene synthase 1 OS=Arachis hypogaea PE=2 SV=1[more]
2PS_GERHY1.158e-8176.402-pyrone synthase OS=Gerbera hybrida GN=2PS PE=1 S... [more]
ACS2_RUTGR3.662e-8071.27Acridone synthase 2 OS=Ruta graveolens GN=ACS2 PE=... [more]
CHSG_PETHY8.879e-7974.59Chalcone synthase G OS=Petunia hybrida GN=CHSG PE=... [more]
ACS3_RUTGR8.879e-7970.17Probable acridone synthase 3 OS=Ruta graveolens GN... [more]
ACS4_RUTGR1.511e-7870.72Probable acridone synthase 4 OS=Ruta graveolens GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H02EF DevOvary1 Citrus clementina cDNA clone C32001H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876218 ID=FC876218|Name=FC876218|organism=Citrus clementina|type=EST|length=675bp
GACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGTGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCGGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCT
back to top