FC876218

Overview
NameFC876218
Unique NameFC876218
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length675
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..681. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS1_SOLLC (Chalcone synthase 1 OS=Solanum lycopersicum GN=CHS1 PE=2 SV=2)

HSP 1 Score: 318.931 bits (816), Expect = 2.768e-95
Identity = 153/181 (84.53%), Postives = 165/181 (91.16%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV+E R AQRA+GPAT+LAIGT+TP++ V+Q+ YPDYYFRIT SEH TELKEKFKRMCDKSMIKKRYM+LTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGK    KAIKEWGQPKSKITHL+FCTTSGVDMP  DYQL KL+ +RPSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVTVEEYRKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKRGTQKAIKEWGQPKSKITHLVFCTTSGVDMPACDYQLAKLLPVRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 51.6026 bits (122), Expect = 2.768e-95
Identity = 23/27 (85.19%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+++HLDS
Sbjct:  182 KGARVLVVCSEITAVTFRGPSESHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS2_PEA (Chalcone synthase 2 OS=Pisum sativum GN=CHS2 PE=2 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 2.768e-95
Identity = 152/181 (83.98%), Postives = 167/181 (92.27%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV EIR AQRA+GPAT+LAIGTA PA+ V Q+ YPD+YF+IT SEH T LKEKF+RMCDKSMIK+RYMYLTE+ILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTV RLAKDLAENN
Sbjct:    1 MVTVSEIRKAQRAEGPATILAIGTANPANCVEQSTYPDFYFKITNSEHKTVLKEKFQRMCDKSMIKRRYMYLTEDILKENPSLCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVFRLAKDLAENN 181          

HSP 2 Score: 51.9878 bits (123), Expect = 2.768e-95
Identity = 23/27 (85.19%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            + ARVLVVCSE+TAVTFRGP+DTHLDS
Sbjct:  182 KNARVLVVCSEVTAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS3_IPOBA (Chalcone synthase LF3 OS=Ipomoea batatas GN=CHS-LF3 PE=2 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 2.768e-95
Identity = 155/181 (85.64%), Postives = 166/181 (91.71%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV E+R AQRA+GPAT+LAIGTATPA+ VNQ+ YPDYYFRIT SEH TELKEKF+RMCDKSMI KRYM+LTEEILKENP+ C YMAPSLDARQDI VVEVPKLGKEAA  AIK WGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVTVGEVRKAQRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKGWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 49.2914 bits (116), Expect = 2.768e-95
Identity = 21/27 (77.78%), Postives = 25/27 (92.59%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVL+VCSEIT VTFRGP++ HLDS
Sbjct:  182 KGARVLIVCSEITVVTFRGPSEAHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS1_CICAR (Chalcone synthase 1 OS=Cicer arietinum GN=CHS1 PE=2 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 4.711e-95
Identity = 150/181 (82.87%), Postives = 166/181 (91.71%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V EIR AQRA+GPAT+LAIGTA P++ V Q+ YPD+YF+IT SEH  ELK+KF+RMCDKSMIK RYMYLTEEILKENP++C YMAPSLD RQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPSNRVEQSTYPDFYFKITNSEHKVELKQKFQRMCDKSMIKSRYMYLTEEILKENPSVCEYMAPSLDVRQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.299 bits (129), Expect = 4.711e-95
Identity = 24/27 (88.89%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSE+TAVTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS1_SECCE (Chalcone synthase 1 OS=Secale cereale GN=CHS1 PE=3 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 6.145e-95
Identity = 156/179 (87.15%), Postives = 171/179 (95.53%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            TV+E+R AQRA+GPATVLAIGTATPA+ V QADYPDYYF+ITKS+HM +LKEKFKRMCDKS I+KRYM+LTEEIL++NPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQP+SKITHL+FCTTSGVDMPGADYQLTK++GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    6 TVEEVRKAQRAEGPATVLAIGTATPANCVYQADYPDYYFKITKSDHMADLKEKFKRMCDKSQIRKRYMHLTEEILQDNPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPRSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 184          

HSP 2 Score: 41.5874 bits (96), Expect = 6.145e-95
Identity = 19/20 (95.00%), Postives = 20/20 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGP 654
            +GARVLVVCSEITAVTFRGP
Sbjct:  185 RGARVLVVCSEITAVTFRGP 204          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSY_DIACA (Chalcone synthase OS=Dianthus caryophyllus GN=CHS PE=2 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 1.780e-94
Identity = 154/181 (85.08%), Postives = 170/181 (93.92%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            MA+++EIR A RADGPAT+LAIGTATP +++ QADYPDYYFR+TKSEHMTELKEKF+RMCDKSMIKKRYMYLTEEILKENPN+C YM  SLD RQD+VV EVP+LGKEAA KAIKEWGQPKSKITH+I CTTSGVDMPGADYQLTKL+GLRPSV+RFM+YQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MASIEEIRQAPRADGPATILAIGTATPPNAIYQADYPDYYFRVTKSEHMTELKEKFRRMCDKSMIKKRYMYLTEEILKENPNLCEYMGSSLDTRQDMVVSEVPRLGKEAAVKAIKEWGQPKSKITHVIMCTTSGVDMPGADYQLTKLLGLRPSVRRFMLYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 41.5874 bits (96), Expect = 1.780e-94
Identity = 19/25 (76.00%), Postives = 21/25 (84.00%), Query Frame = 1
Query:  601 ARVLVVCSEITAVTFRGPADTHLDS 675
            ARVLVVCSEITA+ FRGP +  LDS
Sbjct:  184 ARVLVVCSEITAICFRGPTEAALDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS5_MEDSA (Chalcone synthase 4-2 OS=Medicago sativa GN=CHS4-2 PE=2 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 3.030e-94
Identity = 151/181 (83.43%), Postives = 165/181 (91.16%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V EIRNAQRA+GPAT LAIGTA P + V Q+ YPD+YF+IT SEH TELKEKF+RMCDKSMIK+RYMYLTEEILKENP++C  MAPSLDA QD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLI CTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVSEIRNAQRAEGPATTLAIGTANPTNCVEQSTYPDFYFKITNSEHKTELKEKFQRMCDKSMIKRRYMYLTEEILKENPSVCEIMAPSLDAWQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIVCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.299 bits (129), Expect = 3.030e-94
Identity = 24/27 (88.89%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSE+TAVTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS1_MEDSA (Chalcone synthase 1 OS=Medicago sativa GN=CHS1 PE=2 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 3.628e-92
Identity = 148/181 (81.77%), Postives = 164/181 (90.61%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V EIR AQRA+GPAT++AIGTA PA+ V Q+ YPD+YF+IT SEH  ELKEKF+RMCDKSMIK+RYMYLTEEILK+NP +C YMAPSL ARQD+ VV VP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVAEIRQAQRAEGPATIMAIGTANPANCVEQSTYPDFYFKITNSEHKVELKEKFQRMCDKSMIKRRYMYLTEEILKDNPRVCEYMAPSLAARQDMAVVVVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 50.0618 bits (118), Expect = 3.628e-92
Identity = 23/27 (85.19%), Postives = 25/27 (92.59%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSE T VTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEETPVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS1_MAIZE (Chalcone synthase WHP1 OS=Zea mays GN=WHP1 PE=3 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 3.969e-91
Identity = 148/179 (82.68%), Postives = 163/179 (91.06%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            TV E+R  QRA GPATVLAIGTATPA+ V QADYPDYYFRITKS+H+T+LKEKFKRMCDKSMI+KRYM+LTEE L ENP+MCAYMAPSLDARQD+VV EVPKLGK AA +AIKEWGQPKS+ITHL+FCTTSGVDMPGADYQLTK +GLR  V R MMYQQGCFAGGTVLR+AKD+AENN
Sbjct:    7 TVDEVRKGQRATGPATVLAIGTATPANCVYQADYPDYYFRITKSDHLTDLKEKFKRMCDKSMIRKRYMHLTEEFLSENPSMCAYMAPSLDARQDVVVTEVPKLGKAAAQEAIKEWGQPKSRITHLVFCTTSGVDMPGADYQLTKALGLR-VVNRLMMYQQGCFAGGTVLRVAKDVAENN 184          

HSP 2 Score: 49.6766 bits (117), Expect = 3.969e-91
Identity = 21/27 (77.78%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARV+VVCSEITAVTFRGP+++H+DS
Sbjct:  185 RGARVMVVCSEITAVTFRGPSESHVDS 211          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSY_ONOVI (Chalcone synthase OS=Onobrychis viciifolia GN=CHS PE=2 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 1.500e-90
Identity = 145/181 (80.11%), Postives = 158/181 (87.29%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M  V E R  QRA+GP T+ AI TA P + V Q+ YPD+YF+IT SEH  ELKEKF+RM DKSMIK+RYMYLTEEILKENPN+C YMAPSLDARQD+ VVEVP+LGKEAA KAIKEWGQPKSKITHLI CTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVDVAESRRTQRAEGPRTIFAIATANPPNCVEQSTYPDFYFKITNSEHKVELKEKFQRMDDKSMIKRRYMYLTEEILKENPNVCEYMAPSLDARQDMFVVEVPRLGKEAAVKAIKEWGQPKSKITHLIVCTTSGVDMPGADYQLTKLLGLRPHVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.299 bits (129), Expect = 1.500e-90
Identity = 24/27 (88.89%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSE+TAVTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDS 208          
The following BLAST results are available for this feature:
BLAST of FC876218 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHS1_SOLLC2.768e-9584.53Chalcone synthase 1 OS=Solanum lycopersicum GN=CHS... [more]
CHS2_PEA2.768e-9583.98Chalcone synthase 2 OS=Pisum sativum GN=CHS2 PE=2 ... [more]
CHS3_IPOBA2.768e-9585.64Chalcone synthase LF3 OS=Ipomoea batatas GN=CHS-LF... [more]
CHS1_CICAR4.711e-9582.87Chalcone synthase 1 OS=Cicer arietinum GN=CHS1 PE=... [more]
CHS1_SECCE6.145e-9587.15Chalcone synthase 1 OS=Secale cereale GN=CHS1 PE=3... [more]
CHSY_DIACA1.780e-9485.08Chalcone synthase OS=Dianthus caryophyllus GN=CHS ... [more]
CHS5_MEDSA3.030e-9483.43Chalcone synthase 4-2 OS=Medicago sativa GN=CHS4-2... [more]
CHS1_MEDSA3.628e-9281.77Chalcone synthase 1 OS=Medicago sativa GN=CHS1 PE=... [more]
CHS1_MAIZE3.969e-9182.68Chalcone synthase WHP1 OS=Zea mays GN=WHP1 PE=3 SV... [more]
CHSY_ONOVI1.500e-9080.11Chalcone synthase OS=Onobrychis viciifolia GN=CHS ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H02EF DevOvary1 Citrus clementina cDNA clone C32001H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876218 ID=FC876218|Name=FC876218|organism=Citrus clementina|type=EST|length=675bp
GACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGTGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCGGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCT
back to top