FC876220

Overview
NameFC876220
Unique NameFC876220
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length716
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:8..724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS3_SORBI (Chalcone synthase 3 OS=Sorghum bicolor GN=CHS3 PE=3 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 7.902e-106
Identity = 158/180 (87.78%), Postives = 170/180 (94.44%), Query Frame = 3
Query:   57 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMT+LKEKFKRMCDKS I+KRY++LTEE L ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSV R MMYQQGCFAGGTVLR+AKDLAENNR
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTDLKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENNR 186          

HSP 2 Score: 76.6406 bits (187), Expect = 7.902e-106
Identity = 36/41 (87.80%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+++HLDS+VGQALFGDGAAAV
Sbjct:  186 RGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAV 226          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS7_SORBI (Chalcone synthase 7 OS=Sorghum bicolor GN=CHS7 PE=3 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 7.903e-106
Identity = 158/180 (87.78%), Postives = 170/180 (94.44%), Query Frame = 3
Query:   57 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMT+LKEKFKRMCDKS I+KRY++LTEE L ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSV R MMYQQGCFAGGTVLR+AKDLAENNR
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTDLKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENNR 186          

HSP 2 Score: 76.6406 bits (187), Expect = 7.903e-106
Identity = 36/41 (87.80%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+++HLDS+VGQALFGDGAAAV
Sbjct:  186 RGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAV 226          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSY_CALCH (Chalcone synthase OS=Callistephus chinensis GN=CHS PE=2 SV=2)

HSP 1 Score: 326.25 bits (835), Expect = 7.903e-106
Identity = 156/179 (87.15%), Postives = 169/179 (94.41%), Query Frame = 3
Query:   60 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            +  IR AQR  GPAT+LAIGTATP++ V QADYPDYYFRITKSEHM +LKEKFKRMCDKSMI+KRY++LTEE LKENP++C YMAPSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    7 IAAIREAQRRQGPATILAIGTATPSNCVYQADYPDYYFRITKSEHMVDLKEKFKRMCDKSMIRKRYMHLTEEYLKENPSLCEYMAPSLDARQDVVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNK 185          

HSP 2 Score: 79.337 bits (194), Expect = 7.903e-106
Identity = 39/41 (95.12%), Postives = 40/41 (97.56%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP DTHLDSLVGQALFGDGAAAV
Sbjct:  185 KGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAV 225          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSE_IPOPU (Chalcone synthase E OS=Ipomoea purpurea GN=CHSE PE=2 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 7.904e-106
Identity = 155/182 (85.16%), Postives = 172/182 (94.51%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M TV+E+R AQRA GPAT++AIGT+TP + V+Q+ YPDYYFRIT SEH+ ELKEKFKRMC+KSMIKKRY+YLTEEIL ENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GL+PSVKRFMMYQQGCFAGGTV+RLAKDLAENN+
Sbjct:    1 MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEKSMIKKRYMYLTEEILTENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENNK 182          

HSP 2 Score: 77.411 bits (189), Expect = 7.904e-106
Identity = 37/41 (90.24%), Postives = 40/41 (97.56%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+
Sbjct:  182 KGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAAL 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS2_SOLTU (Chalcone synthase 2 OS=Solanum tuberosum GN=CHS2 PE=2 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 1.031e-105
Identity = 156/182 (85.71%), Postives = 172/182 (94.51%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M TV+E+R AQRA GPAT++AIGTATP++ V+Q+ YPDYYFRIT SEHMTELKEKFKRMCDKSMI KRY++LTEEILKENPN+C YMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTV+RLAKDLAENN+
Sbjct:    1 MVTVEEVRKAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMINKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAENNK 182          

HSP 2 Score: 76.2554 bits (186), Expect = 1.031e-105
Identity = 36/41 (87.80%), Postives = 40/41 (97.56%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTF GP+DTHLDS+VGQALFGDGAAA+
Sbjct:  182 KGARVLVVCSEITAVTFSGPSDTHLDSMVGQALFGDGAAAM 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSA_SOLTU (Chalcone synthase 1A OS=Solanum tuberosum GN=CHS1A PE=2 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 1.031e-105
Identity = 157/182 (86.26%), Postives = 170/182 (93.41%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M TV+E R AQRA+GPAT+LAIGT+TP++ V+Q+ YPDYYFRIT SEH TELKEKFKRMCDKSMIKKRY++LTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPG DYQL KL+GLRPSVKR MMYQQGCF GGTVLRLAKDLAENN+
Sbjct:    1 MVTVEEYRKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGCDYQLAKLLGLRPSVKRLMMYQQGCFVGGTVLRLAKDLAENNK 182          

HSP 2 Score: 77.0258 bits (188), Expect = 1.031e-105
Identity = 36/41 (87.80%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+++HLDSLVGQALFGDGAAA+
Sbjct:  182 KGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAI 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSA_PEA (Chalcone synthase 1A OS=Pisum sativum GN=CHS-1A PE=3 SV=1)

HSP 1 Score: 324.324 bits (830), Expect = 1.345e-105
Identity = 156/182 (85.71%), Postives = 170/182 (93.41%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M TV EIR AQRA+GPATV AIGTATP + V Q+ YPD+YFRIT S+H TELKEKF+RMCDKSMIKKRY++LTEEILKENP++C YMAPSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVTVNEIRQAQRAEGPATVFAIGTATPQNCVEQSTYPDFYFRITNSQHKTELKEKFQRMCDKSMIKKRYMHLTEEILKENPSLCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 80.4925 bits (197), Expect = 1.345e-105
Identity = 39/41 (95.12%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+DTHLDSLVGQALFGDGAAAV
Sbjct:  182 KGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAV 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS7_SOYBN (Chalcone synthase 7 OS=Glycine max GN=CHS7 PE=3 SV=1)

HSP 1 Score: 324.324 bits (830), Expect = 1.345e-105
Identity = 156/182 (85.71%), Postives = 169/182 (92.86%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M +V EIR AQRA+GPAT+LAIGTA P + V+Q+ YPDYYFRIT S+HMTELKEKF+RMCDKSMIK RY+YL EEILKENPNMCAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTK +GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVSVAEIRQAQRAEGPATILAIGTANPPNRVDQSTYPDYYFRITNSDHMTELKEKFQRMCDKSMIKTRYMYLNEEILKENPNMCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKQLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 80.4925 bits (197), Expect = 1.345e-105
Identity = 39/41 (95.12%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+DTHLDSLVGQALFGDGAAAV
Sbjct:  182 KGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAV 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS2_SECCE (Chalcone synthase 2 OS=Secale cereale GN=CHS2 PE=2 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 1.755e-105
Identity = 156/180 (86.67%), Postives = 172/180 (95.56%), Query Frame = 3
Query:   57 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            TV+E+R AQRA+GPATVLAIGTATPA+ V QADYPDYYF+ITKS+HM +LKEKFKRMCDKS I+KRY++LTEEIL++NPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQP+SKITHL+FCTTSGVDMPGADYQLTK++GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENNR
Sbjct:    6 TVEEVRKAQRAEGPATVLAIGTATPANCVYQADYPDYYFKITKSDHMADLKEKFKRMCDKSQIRKRYMHLTEEILQDNPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPRSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNR 185          

HSP 2 Score: 76.2554 bits (186), Expect = 1.755e-105
Identity = 37/41 (90.24%), Postives = 40/41 (97.56%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP ++HLDSLVGQALFGDGAAAV
Sbjct:  185 RGARVLVVCSEITAVTFRGPHESHLDSLVGQALFGDGAAAV 225          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS2_SOLLC (Chalcone synthase 2 OS=Solanum lycopersicum GN=CHS2 PE=2 SV=2)

HSP 1 Score: 328.946 bits (842), Expect = 1.755e-105
Identity = 156/182 (85.71%), Postives = 172/182 (94.51%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M TV+E+R AQRA GPAT++AIGTATP++ V+Q+ YPDYYFRIT SEHMTELKEKFKRMCDKSMI KRY++LTEEILKENPN+C YMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTV+RLAKDLAENN+
Sbjct:    1 MVTVEEVRRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMINKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAENNK 182          

HSP 2 Score: 75.485 bits (184), Expect = 1.755e-105
Identity = 36/41 (87.80%), Postives = 40/41 (97.56%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+DTHLDS+VGQALFGD AAA+
Sbjct:  182 KGARVLVVCSEITAVTFRGPSDTHLDSMVGQALFGDRAAAM 222          
The following BLAST results are available for this feature:
BLAST of FC876220 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHS3_SORBI7.902e-10687.78Chalcone synthase 3 OS=Sorghum bicolor GN=CHS3 PE=... [more]
CHS7_SORBI7.903e-10687.78Chalcone synthase 7 OS=Sorghum bicolor GN=CHS7 PE=... [more]
CHSY_CALCH7.903e-10687.15Chalcone synthase OS=Callistephus chinensis GN=CHS... [more]
CHSE_IPOPU7.904e-10685.16Chalcone synthase E OS=Ipomoea purpurea GN=CHSE PE... [more]
CHS2_SOLTU1.031e-10585.71Chalcone synthase 2 OS=Solanum tuberosum GN=CHS2 P... [more]
CHSA_SOLTU1.031e-10586.26Chalcone synthase 1A OS=Solanum tuberosum GN=CHS1A... [more]
CHSA_PEA1.345e-10585.71Chalcone synthase 1A OS=Pisum sativum GN=CHS-1A PE... [more]
CHS7_SOYBN1.345e-10585.71Chalcone synthase 7 OS=Glycine max GN=CHS7 PE=3 SV... [more]
CHS2_SECCE1.755e-10586.67Chalcone synthase 2 OS=Secale cereale GN=CHS2 PE=2... [more]
CHS2_SOLLC1.755e-10585.71Chalcone synthase 2 OS=Solanum lycopersicum GN=CHS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H05EF DevOvary1 Citrus clementina cDNA clone C32001H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876220 ID=FC876220|Name=FC876220|organism=Citrus clementina|type=EST|length=716bp
AACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTGAA
ATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCGGC
CACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCAGG
CTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGACG
GAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAGAA
GCGTTACATATACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACATGT
GCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGGTC
GAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAATG
GGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTCCG
GCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCCTG
CGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCCGG
CGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGCGC
TCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGGCC
CTGCCGATACTCATCTTGATTCTCTTGTGGGCCAGGCTTTGTTCGGTGAT
GGTGCTGCTGCTGTGA
back to top