FC876220

Overview
NameFC876220
Unique NameFC876220
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length716
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:8..724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSB_IPONI (Chalcone synthase B (Fragment) OS=Ipomoea nil GN=CHSB PE=3 SV=1)

HSP 1 Score: 252.677 bits (644), Expect = 2.373e-75
Identity = 119/173 (68.79%), Postives = 147/173 (84.97%), Query Frame = 3
Query:   78 AQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            A++ +G A + AIGTATPA+ V+Q  YPD+YFRIT S+H+ E KEKF+R+C+KS I+KR++ LTEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRLAKDLAE+N+
Sbjct:   16 AKKLEGDAKIWAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIRKRHLVLTEELLKKNPNLCTYNETSLNTRQDILVAEVPKLGKEAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAESNK 188          

HSP 2 Score: 51.2174 bits (121), Expect = 2.373e-75
Identity = 25/41 (60.98%), Postives = 31/41 (75.61%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +G RVLVVC+EIT   FRGP+    D+L+ Q LFGDGAAA+
Sbjct:  188 KGGRVLVVCAEITINIFRGPSLEQDDNLLAQCLFGDGAAAM 228          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSA_IPOCO (Chalcone synthase A (Fragment) OS=Ipomoea cordatotriloba GN=CHSA PE=3 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 2.373e-75
Identity = 122/173 (70.52%), Postives = 146/173 (84.39%), Query Frame = 3
Query:   78 AQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            A+R +G A +LAIGTATP + V+QA YPD+YFRIT SEH+ E KEKF+R+C+KS I+KR++ LTEE+LKENPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRL K LAENN+
Sbjct:   14 AKRFEGHAKLLAIGTATPTNWVDQATYPDFYFRITNSEHLLEHKEKFRRICNKSKIRKRHLVLTEELLKENPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLVKGLAENNK 186          

HSP 2 Score: 50.0618 bits (118), Expect = 2.373e-75
Identity = 25/41 (60.98%), Postives = 31/41 (75.61%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCS IT   FRGP+    D+L+ Q LFGDG+AA+
Sbjct:  186 KGARVLVVCSGITINIFRGPSLEQDDNLLAQCLFGDGSAAM 226          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSB_IPOTF (Chalcone synthase B (Fragment) OS=Ipomoea trifida GN=CHSB PE=3 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.168e-74
Identity = 122/177 (68.93%), Postives = 148/177 (83.62%), Query Frame = 3
Query:   72 RNAQR--ADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            R A+R   +G A +LAIGTATPA+ V+Q  YPD+YFRIT S+H+ E KEKF+R+C+KS I+KR++ LTEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIK WG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRLAKDLAENN+
Sbjct:   14 RRAKRFEIEGYAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSNIRKRHMVLTEELLKKNPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKAIKVWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNK 190          

HSP 2 Score: 51.9878 bits (123), Expect = 1.168e-74
Identity = 24/41 (58.54%), Postives = 31/41 (75.61%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSE+    FRGP+    D+L+ Q LFGDG+AA+
Sbjct:  190 KGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAI 230          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSC_IPOPU (Chalcone synthase C (Fragment) OS=Ipomoea purpurea GN=CHSC PE=3 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 1.168e-74
Identity = 119/175 (68.00%), Postives = 145/175 (82.86%), Query Frame = 3
Query:   72 RNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            R  +R DG A +LAIGTA PA+ V+Q  YPD+YFRIT SEH+ E KEKF+R+C+KS I+KR++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCT+SGVDMPGAD+QL KL+GL  SV R MMYQQGC AG  +LRLAKDLAENN+
Sbjct:   14 RREKRFDGHAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEYKEKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVNRLMMYQQGCNAGAVMLRLAKDLAENNK 188          

HSP 2 Score: 50.8322 bits (120), Expect = 1.168e-74
Identity = 24/41 (58.54%), Postives = 30/41 (73.17%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +G RVLVVCSE+    FRGP+    D+L+ Q LFGDG+AAV
Sbjct:  188 KGGRVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAV 228          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSA_IPOTR (Chalcone synthase A (Fragment) OS=Ipomoea triloba GN=CHSA PE=3 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 4.408e-74
Identity = 119/173 (68.79%), Postives = 145/173 (83.82%), Query Frame = 3
Query:   78 AQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            A+R +G A +LAIGTATP + V+QA YPD+YFRIT SE + E KEKF+R+C+KS I+ R++ LTEE+LK++PN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRL KDLAENN+
Sbjct:   14 AKRFEGHAKLLAIGTATPTNWVDQATYPDFYFRITNSERLLEHKEKFRRICNKSKIRFRHLVLTEELLKKSPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLVKDLAENNK 186          

HSP 2 Score: 52.7582 bits (125), Expect = 4.408e-74
Identity = 26/41 (63.41%), Postives = 32/41 (78.05%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEIT   FRGP+    D+L+ Q LFGDG+AA+
Sbjct:  186 KGARVLVVCSEITINIFRGPSLEQDDNLLAQCLFGDGSAAM 226          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSA_IPONI (Chalcone synthase A (Fragment) OS=Ipomoea nil GN=CHSA PE=3 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 9.782e-74
Identity = 118/175 (67.43%), Postives = 145/175 (82.86%), Query Frame = 3
Query:   72 RNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            R  +R +G A +LAIGTA PA+ V+Q  YPD+YFRIT SEH+ E KEKF+R+C+KS I+KR++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCT+SGVDMPGAD+QL KL+GL  SV R MMYQQGC AG  +LRLAKDLAENN+
Sbjct:   11 RREKRIEGHAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVNRLMMYQQGCNAGAAMLRLAKDLAENNK 185          

HSP 2 Score: 49.2914 bits (116), Expect = 9.782e-74
Identity = 24/41 (58.54%), Postives = 29/41 (70.73%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +G RVLVVCSE+    FRGP+    D L+ Q LFGDG+AAV
Sbjct:  185 KGGRVLVVCSEVMLNVFRGPSLEQEDYLLAQCLFGDGSAAV 225          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSB_IPOTR (Chalcone synthase B (Fragment) OS=Ipomoea triloba GN=CHSB PE=3 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 2.169e-73
Identity = 119/177 (67.23%), Postives = 149/177 (84.18%), Query Frame = 3
Query:   72 RNAQR--ADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            R A+R   +G A +LAIGTATPA+ V+Q  YPD+YFRIT S+H+ E KEKF+R+C+KS I+KR++ LTEE+L++NP++C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD++LTKL+GL  SVKR MMYQQGC AG  +LRLAKDLAE+N+
Sbjct:   14 RRAKRFEIEGYAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIRKRHLVLTEELLQKNPSLCTYNETSLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFRLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAESNK 190          

HSP 2 Score: 50.8322 bits (120), Expect = 2.169e-73
Identity = 24/41 (58.54%), Postives = 31/41 (75.61%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +G R+LVVCSEIT   FRGP+    D+L+ Q LFGDG+AA+
Sbjct:  190 KGGRILVVCSEITINIFRGPSLEQDDNLLAQCLFGDGSAAM 230          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: TBSYN_HYPAN (Trihydroxybenzophenone synthase OS=Hypericum androsaemum PE=1 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 1.067e-72
Identity = 115/165 (69.70%), Postives = 133/165 (80.61%), Query Frame = 3
Query:   99 ATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 593
            A+VLAIGT  P H + Q DYPD+YFR T SEHMTELKEKFKR+C KS I+KR+ YLTEEILKEN  +  Y A SLDARQ I+  EVPKLG+EAA KAI EWGQP SKITH++F TTSG  MPGADY +T+L+GL  +V+R M+Y QGCFAGGT LR+AKDLAENN
Sbjct:   20 ASVLAIGTTNPEHFILQEDYPDFYFRNTNSEHMTELKEKFKRICVKSHIRKRHFYLTEEILKENQGIATYGAGSLDARQRILETEVPKLGQEAALKAIAEWGQPISKITHVVFATTSGFMMPGADYVITRLLGLNRTVRRVMLYNQGCFAGGTALRVAKDLAENN 184          

HSP 2 Score: 60.077 bits (144), Expect = 1.067e-72
Identity = 27/41 (65.85%), Postives = 35/41 (85.37%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVC+E TA+TF  P ++HLD +VGQA+F DGAAA+
Sbjct:  185 EGARVLVVCAENTAMTFHAPNESHLDVIVGQAMFSDGAAAL 225          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: VPS_PSINU (Phloroisovalerophenone synthase OS=Psilotum nudum GN=VPS PE=2 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 1.391e-72
Identity = 111/175 (63.43%), Postives = 140/175 (80.00%), Query Frame = 3
Query:   72 RNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            R  +RA GP +VLAIG+A P +  +Q+ +PD+YF IT+S HM E+K KF RMC KS IKKR +++ E+IL+ +P++ +Y   SLD RQD++V EVPKLGK AA  AI EWGQPKS ITHLIFCT+SG+DMPGAD+ L KL+GLRP+V R M+YQQGCFAG TVLR+AKDLAENN+
Sbjct:   15 RKKERASGPVSVLAIGSANPPNVFHQSLFPDFYFNITQSNHMAEVKAKFTRMCAKSGIKKRRMHINEDILEAHPSIRSYHDNSLDVRQDMLVEEVPKLGKVAADNAIAEWGQPKSNITHLIFCTSSGIDMPGADWALMKLLGLRPTVNRVMVYQQGCFAGCTVLRIAKDLAENNK 189          

HSP 2 Score: 63.5438 bits (153), Expect = 1.391e-72
Identity = 27/41 (65.85%), Postives = 37/41 (90.24%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +G+R+LVVCSE+T ++FRGP + H ++LVGQALFGDGAAA+
Sbjct:  189 KGSRILVVCSELTLISFRGPTEDHPENLVGQALFGDGAAAL 229          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: BBS_PHASS (Bibenzyl synthase OS=Phalaenopsis sp. GN=BIBSY212 PE=2 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 5.249e-72
Identity = 106/182 (58.24%), Postives = 146/182 (80.22%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M +++ I+ A RADG A++LAIG A P + + Q+ YPD+YFR+T SEH+ +LK+KF+R+C+K+ I+KR+    EE L  NP    +M  SL+ RQ++ + E+PKLG +AATKAI++WGQPKS+ITHLIFCTTSG+D+PGADYQLT+++GL P+V+R M+YQQGCFAGGT LRLAK LAE+ +
Sbjct:    1 MLSLESIKKAPRADGFASILAIGRANPDNIIEQSAYPDFYFRVTNSEHLVDLKKKFQRICEKTAIRKRHFVWNEEFLTANPCFSTFMDKSLNVRQEVAISEIPKLGAKAATKAIEDWGQPKSRITHLIFCTTSGMDLPGADYQLTQILGLNPNVERVMLYQQGCFAGGTTLRLAKCLAESRK 182          

HSP 2 Score: 57.3806 bits (137), Expect = 5.249e-72
Identity = 27/42 (64.29%), Postives = 33/42 (78.57%), Query Frame = 2
Query:  590 QQGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            ++GARVLVVC+E T V FR P++ H D LV QALF DGA+AV
Sbjct:  181 RKGARVLVVCAETTTVLFRAPSEEHQDDLVTQALFADGASAV 222          
The following BLAST results are available for this feature:
BLAST of FC876220 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHSB_IPONI2.373e-7568.79Chalcone synthase B (Fragment) OS=Ipomoea nil GN=C... [more]
CHSA_IPOCO2.373e-7570.52Chalcone synthase A (Fragment) OS=Ipomoea cordatot... [more]
CHSB_IPOTF1.168e-7468.93Chalcone synthase B (Fragment) OS=Ipomoea trifida ... [more]
CHSC_IPOPU1.168e-7468.00Chalcone synthase C (Fragment) OS=Ipomoea purpurea... [more]
CHSA_IPOTR4.408e-7468.79Chalcone synthase A (Fragment) OS=Ipomoea triloba ... [more]
CHSA_IPONI9.782e-7467.43Chalcone synthase A (Fragment) OS=Ipomoea nil GN=C... [more]
CHSB_IPOTR2.169e-7367.23Chalcone synthase B (Fragment) OS=Ipomoea triloba ... [more]
TBSYN_HYPAN1.067e-7269.70Trihydroxybenzophenone synthase OS=Hypericum andro... [more]
VPS_PSINU1.391e-7263.43Phloroisovalerophenone synthase OS=Psilotum nudum ... [more]
BBS_PHASS5.249e-7258.24Bibenzyl synthase OS=Phalaenopsis sp. GN=BIBSY212 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H05EF DevOvary1 Citrus clementina cDNA clone C32001H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876220 ID=FC876220|Name=FC876220|organism=Citrus clementina|type=EST|length=716bp
AACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTGAA
ATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCGGC
CACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCAGG
CTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGACG
GAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAGAA
GCGTTACATATACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACATGT
GCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGGTC
GAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAATG
GGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTCCG
GCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCCTG
CGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCCGG
CGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGCGC
TCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGGCC
CTGCCGATACTCATCTTGATTCTCTTGTGGGCCAGGCTTTGTTCGGTGAT
GGTGCTGCTGCTGTGA
back to top