FC876220

Overview
NameFC876220
Unique NameFC876220
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length716
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:8..724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS1_SOLLC (Chalcone synthase 1 OS=Solanum lycopersicum GN=CHS1 PE=2 SV=2)

HSP 1 Score: 318.161 bits (814), Expect = 1.039e-102
Identity = 152/182 (83.52%), Postives = 166/182 (91.21%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M TV+E R AQRA+GPAT+LAIGT+TP++ V+Q+ YPDYYFRIT SEH TELKEKFKRMCDKSMIKKRY++LTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGK    KAIKEWGQPKSKITHL+FCTTSGVDMP  DYQL KL+ +RPSVKR MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVTVEEYRKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKRGTQKAIKEWGQPKSKITHLVFCTTSGVDMPACDYQLAKLLPVRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 77.0258 bits (188), Expect = 1.039e-102
Identity = 36/41 (87.80%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+++HLDSLVGQALFGDGAAA+
Sbjct:  182 KGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAI 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS1_SECCE (Chalcone synthase 1 OS=Secale cereale GN=CHS1 PE=3 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 1.768e-102
Identity = 156/180 (86.67%), Postives = 172/180 (95.56%), Query Frame = 3
Query:   57 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            TV+E+R AQRA+GPATVLAIGTATPA+ V QADYPDYYF+ITKS+HM +LKEKFKRMCDKS I+KRY++LTEEIL++NPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQP+SKITHL+FCTTSGVDMPGADYQLTK++GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENNR
Sbjct:    6 TVEEVRKAQRAEGPATVLAIGTATPANCVYQADYPDYYFKITKSDHMADLKEKFKRMCDKSQIRKRYMHLTEEILQDNPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPRSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNR 185          

HSP 2 Score: 66.2402 bits (160), Expect = 1.768e-102
Identity = 35/41 (85.37%), Postives = 37/41 (90.24%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP +   DSLVGQALFGDGAAAV
Sbjct:  185 RGARVLVVCSEITAVTFRGPHE--FDSLVGQALFGDGAAAV 223          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSY_DIAMO (Chalcone synthase OS=Dianthus monspessulanus GN=CHS PE=2 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 1.768e-102
Identity = 154/182 (84.62%), Postives = 172/182 (94.51%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            MA+++EIR AQRADGPAT+LAIGTATP +++ QADYPDYYFR+TKSEHMTELKEKF+RMCDKSMIKKRY+YLTEEILKENPN+C YM  SLD RQD+VV EVP+LGKEAA KAIKEWGQPKSKITH+I CTTSGVDMPGADYQLTKL+GLRPSV+RFM+YQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MASIEEIRQAQRADGPATILAIGTATPPNAIYQADYPDYYFRVTKSEHMTELKEKFRRMCDKSMIKKRYMYLTEEILKENPNLCEYMGSSLDTRQDMVVSEVPRLGKEAAVKAIKEWGQPKSKITHVIMCTTSGVDMPGADYQLTKLLGLRPSVRRFMLYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 66.6254 bits (161), Expect = 1.768e-102
Identity = 31/41 (75.61%), Postives = 36/41 (87.80%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITA+ FRGP +  LDS+VGQALFGDGA A+
Sbjct:  182 KGARVLVVCSEITAICFRGPTEAALDSMVGQALFGDGAGAL 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS2_PEA (Chalcone synthase 2 OS=Pisum sativum GN=CHS2 PE=2 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 1.768e-102
Identity = 151/182 (82.97%), Postives = 168/182 (92.31%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M TV EIR AQRA+GPAT+LAIGTA PA+ V Q+ YPD+YF+IT SEH T LKEKF+RMCDKSMIK+RY+YLTE+ILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTV RLAKDLAENN+
Sbjct:    1 MVTVSEIRKAQRAEGPATILAIGTANPANCVEQSTYPDFYFKITNSEHKTVLKEKFQRMCDKSMIKRRYMYLTEDILKENPSLCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVFRLAKDLAENNK 182          

HSP 2 Score: 76.6406 bits (187), Expect = 1.768e-102
Identity = 36/41 (87.80%), Postives = 40/41 (97.56%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            + ARVLVVCSE+TAVTFRGP+DTHLDSLVGQALFGDGAAA+
Sbjct:  182 KNARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS1_CICAR (Chalcone synthase 1 OS=Cicer arietinum GN=CHS1 PE=2 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 3.010e-102
Identity = 149/182 (81.87%), Postives = 167/182 (91.76%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M +V EIR AQRA+GPAT+LAIGTA P++ V Q+ YPD+YF+IT SEH  ELK+KF+RMCDKSMIK RY+YLTEEILKENP++C YMAPSLD RQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPSNRVEQSTYPDFYFKITNSEHKVELKQKFQRMCDKSMIKSRYMYLTEEILKENPSVCEYMAPSLDVRQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 78.9518 bits (193), Expect = 3.010e-102
Identity = 37/41 (90.24%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSE+TAVTFRGP+DTHLDSLVGQALFGDGAAA+
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS5_MEDSA (Chalcone synthase 4-2 OS=Medicago sativa GN=CHS4-2 PE=2 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 1.937e-101
Identity = 150/182 (82.42%), Postives = 166/182 (91.21%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M +V EIRNAQRA+GPAT LAIGTA P + V Q+ YPD+YF+IT SEH TELKEKF+RMCDKSMIK+RY+YLTEEILKENP++C  MAPSLDA QD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLI CTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVSVSEIRNAQRAEGPATTLAIGTANPTNCVEQSTYPDFYFKITNSEHKTELKEKFQRMCDKSMIKRRYMYLTEEILKENPSVCEIMAPSLDAWQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIVCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 78.9518 bits (193), Expect = 1.937e-101
Identity = 37/41 (90.24%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSE+TAVTFRGP+DTHLDSLVGQALFGDGAAA+
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSY_DIACA (Chalcone synthase OS=Dianthus caryophyllus GN=CHS PE=2 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 5.612e-101
Identity = 153/182 (84.07%), Postives = 171/182 (93.96%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            MA+++EIR A RADGPAT+LAIGTATP +++ QADYPDYYFR+TKSEHMTELKEKF+RMCDKSMIKKRY+YLTEEILKENPN+C YM  SLD RQD+VV EVP+LGKEAA KAIKEWGQPKSKITH+I CTTSGVDMPGADYQLTKL+GLRPSV+RFM+YQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MASIEEIRQAPRADGPATILAIGTATPPNAIYQADYPDYYFRVTKSEHMTELKEKFRRMCDKSMIKKRYMYLTEEILKENPNLCEYMGSSLDTRQDMVVSEVPRLGKEAAVKAIKEWGQPKSKITHVIMCTTSGVDMPGADYQLTKLLGLRPSVRRFMLYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 63.929 bits (154), Expect = 5.612e-101
Identity = 30/39 (76.92%), Postives = 34/39 (87.18%), Query Frame = 2
Query:  599 ARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            ARVLVVCSEITA+ FRGP +  LDS+VGQALFGDGA A+
Sbjct:  184 ARVLVVCSEITAICFRGPTEAALDSMVGQALFGDGAGAL 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS1_MEDSA (Chalcone synthase 1 OS=Medicago sativa GN=CHS1 PE=2 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 2.323e-99
Identity = 147/182 (80.77%), Postives = 165/182 (90.66%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M +V EIR AQRA+GPAT++AIGTA PA+ V Q+ YPD+YF+IT SEH  ELKEKF+RMCDKSMIK+RY+YLTEEILK+NP +C YMAPSL ARQD+ VV VP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVSVAEIRQAQRAEGPATIMAIGTANPANCVEQSTYPDFYFKITNSEHKVELKEKFQRMCDKSMIKRRYMYLTEEILKDNPRVCEYMAPSLAARQDMAVVVVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 74.7146 bits (182), Expect = 2.323e-99
Identity = 36/41 (87.80%), Postives = 39/41 (95.12%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSE T VTFRGP+DTHLDSLVGQALFGDGAAA+
Sbjct:  182 KGARVLVVCSEETPVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS1_MAIZE (Chalcone synthase WHP1 OS=Zea mays GN=WHP1 PE=3 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 1.494e-98
Identity = 148/180 (82.22%), Postives = 164/180 (91.11%), Query Frame = 3
Query:   57 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            TV E+R  QRA GPATVLAIGTATPA+ V QADYPDYYFRITKS+H+T+LKEKFKRMCDKSMI+KRY++LTEE L ENP+MCAYMAPSLDARQD+VV EVPKLGK AA +AIKEWGQPKS+ITHL+FCTTSGVDMPGADYQLTK +GLR  V R MMYQQGCFAGGTVLR+AKD+AENNR
Sbjct:    7 TVDEVRKGQRATGPATVLAIGTATPANCVYQADYPDYYFRITKSDHLTDLKEKFKRMCDKSMIRKRYMHLTEEFLSENPSMCAYMAPSLDARQDVVVTEVPKLGKAAAQEAIKEWGQPKSRITHLVFCTTSGVDMPGADYQLTKALGLR-VVNRLMMYQQGCFAGGTVLRVAKDVAENNR 185          

HSP 2 Score: 73.9442 bits (180), Expect = 1.494e-98
Identity = 34/40 (85.00%), Postives = 40/40 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAA 712
            +GARV+VVCSEITAVTFRGP+++H+DSLVGQALFGDGAAA
Sbjct:  185 RGARVMVVCSEITAVTFRGPSESHVDSLVGQALFGDGAAA 224          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSY_ONOVI (Chalcone synthase OS=Onobrychis viciifolia GN=CHS PE=2 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 9.612e-98
Identity = 144/182 (79.12%), Postives = 159/182 (87.36%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M  V E R  QRA+GP T+ AI TA P + V Q+ YPD+YF+IT SEH  ELKEKF+RM DKSMIK+RY+YLTEEILKENPN+C YMAPSLDARQD+ VVEVP+LGKEAA KAIKEWGQPKSKITHLI CTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVDVAESRRTQRAEGPRTIFAIATANPPNCVEQSTYPDFYFKITNSEHKVELKEKFQRMDDKSMIKRRYMYLTEEILKENPNVCEYMAPSLDARQDMFVVEVPRLGKEAAVKAIKEWGQPKSKITHLIVCTTSGVDMPGADYQLTKLLGLRPHVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 78.9518 bits (193), Expect = 9.612e-98
Identity = 37/41 (90.24%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSE+TAVTFRGP+DTHLDSLVGQALFGDGAAA+
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
The following BLAST results are available for this feature:
BLAST of FC876220 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHS1_SOLLC1.039e-10283.52Chalcone synthase 1 OS=Solanum lycopersicum GN=CHS... [more]
CHS1_SECCE1.768e-10286.67Chalcone synthase 1 OS=Secale cereale GN=CHS1 PE=3... [more]
CHSY_DIAMO1.768e-10284.62Chalcone synthase OS=Dianthus monspessulanus GN=CH... [more]
CHS2_PEA1.768e-10282.97Chalcone synthase 2 OS=Pisum sativum GN=CHS2 PE=2 ... [more]
CHS1_CICAR3.010e-10281.87Chalcone synthase 1 OS=Cicer arietinum GN=CHS1 PE=... [more]
CHS5_MEDSA1.937e-10182.42Chalcone synthase 4-2 OS=Medicago sativa GN=CHS4-2... [more]
CHSY_DIACA5.612e-10184.07Chalcone synthase OS=Dianthus caryophyllus GN=CHS ... [more]
CHS1_MEDSA2.323e-9980.77Chalcone synthase 1 OS=Medicago sativa GN=CHS1 PE=... [more]
CHS1_MAIZE1.494e-9882.22Chalcone synthase WHP1 OS=Zea mays GN=WHP1 PE=3 SV... [more]
CHSY_ONOVI9.612e-9879.12Chalcone synthase OS=Onobrychis viciifolia GN=CHS ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H05EF DevOvary1 Citrus clementina cDNA clone C32001H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876220 ID=FC876220|Name=FC876220|organism=Citrus clementina|type=EST|length=716bp
AACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTGAA
ATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCGGC
CACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCAGG
CTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGACG
GAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAGAA
GCGTTACATATACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACATGT
GCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGGTC
GAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAATG
GGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTCCG
GCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCCTG
CGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCCGG
CGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGCGC
TCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGGCC
CTGCCGATACTCATCTTGATTCTCTTGTGGGCCAGGCTTTGTTCGGTGAT
GGTGCTGCTGCTGTGA
back to top