FC876224

Overview
NameFC876224
Unique NameFC876224
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length509
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10322 contig Ccv1_Contig10322:7..515. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P1_TRIKO (Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Trichoderma koningii GN=gpd1 PE=1 SV=3)

HSP 1 Score: 137.117 bits (344), Expect = 4.413e-32
Identity = 73/138 (52.90%), Postives = 91/138 (65.94%), Query Frame = 3
Query:   84 KIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEY 497
            K+GINGFGRIGR+V R  L+   VE+VA+NDPFI   Y  YM KYDS HG++K  ++KV D K L+   K +  +  R+P  IPW ++GAEY+VESTGVFT               VIISAPS DAPM+V+GVNE  Y
Sbjct:    4 KVGINGFGRIGRVVLRNALETGAVEVVALNDPFIEPHYAEYMFKYDSTHGRFKG-DIKV-DGKDLVIDGKRIKFYQERDPANIPWKDSGAEYIVESTGVFTTTEKASAHFKGGAKKVIISAPSADAPMYVMGVNEDTY 139          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P1_KLULA (Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Kluyveromyces lactis GN=GAP1 PE=1 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 5.763e-32
Identity = 70/142 (49.30%), Postives = 92/142 (64.79%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPE 506
            VK+ INGFGRIGRLV R+ LQR  +E+VAVNDPFI+ DY  YM KYDS HG++K  E+    +  ++ G K + VF  ++P  +PW + G + V++STGVF                V+I+APSK APMFVVGVNE +Y  E
Sbjct:    2 VKVAINGFGRIGRLVLRIALQRKALEVVAVNDPFISVDYAAYMFKYDSTHGRYK-GEVTTSGNDLVIDGHK-IAVFQEKDPANLPWGKLGVDIVIDSTGVFKELDSAQKHLDAGAKKVVITAPSKTAPMFVVGVNEDKYNGE 141          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P4_CAEEL (Glyceraldehyde-3-phosphate dehydrogenase 4 OS=Caenorhabditis elegans GN=gpd-4 PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 7.527e-32
Identity = 74/148 (50.00%), Postives = 90/148 (60.81%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEK------PVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEY 497
            M K  +GINGFGRIGRLV R  +++D V++VAVNDPFIT DYM Y+ KYDS HGQ+K     V  D   L  +K       + VF  ++P  I W    A++VVESTGVFT               VIISAPS DAPM+VVGVN  +Y
Sbjct:    1 MSKANVGINGFGRIGRLVLRAAVEKDTVQVVAVNDPFITIDYMVYLFKYDSTHGQFKG---TVTYDGDFLIVQKDGKSSHKIKVFNSKDPAAIAWGSVKADFVVESTGVFTTKEKASAHLQGGAKKVIISAPSADAPMYVVGVNHEKY 145          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P1_CAEEL (Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Caenorhabditis elegans GN=gpd-1 PE=1 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 7.527e-32
Identity = 74/148 (50.00%), Postives = 90/148 (60.81%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEK------PVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEY 497
            M K  +GINGFGRIGRLV R  +++D V++VAVNDPFIT DYM Y+ KYDS HGQ+K     V  D   L  +K       + VF  ++P  I W    A++VVESTGVFT               VIISAPS DAPM+VVGVN  +Y
Sbjct:    1 MSKANVGINGFGRIGRLVLRAAVEKDTVQVVAVNDPFITIDYMVYLFKYDSTHGQFKG---TVTYDGDFLIVQKDGKSSHKIKVFNSKDPAAIAWGSVKADFVVESTGVFTTKEKASAHLQGGAKKVIISAPSADAPMYVVGVNHEKY 145          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P2_SCHPO (Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Schizosaccharomyces pombe GN=gpd3 PE=1 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 9.830e-32
Identity = 71/140 (50.71%), Postives = 91/140 (65.00%), Query Frame = 3
Query:   84 KIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKP 503
            K+GINGFGRIGR+V R  +    +++VAVNDPFI  DYM YM KYDS HG+++   ++ K  K ++ G   + V   R+P  I W+ +GAEYV+ESTGVFT               VIISAPSKDAPMFVVGVN  ++ P
Sbjct:    5 KVGINGFGRIGRIVLRNAILTGKIQVVAVNDPFIDLDYMAYMFKYDSTHGRFE-GSVETKGGKLVIDGHS-IDVHNERDPANIKWSASGAEYVIESTGVFTTKETASAHLKGGAKRVIISAPSKDAPMFVVGVNLEKFNP 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P2_CANGA (Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Candida glabrata GN=GPD2 PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 1.284e-31
Identity = 69/143 (48.25%), Postives = 87/143 (60.84%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            V+I INGFGRIGRLV RV L R ++E+VAVNDPFITTDY  YM KYDS HG++        DDK ++   K + V   R+P  +PW     +  ++STGVF                V+I+APS  APMFVVGVNE +Y  +L
Sbjct:    2 VRIAINGFGRIGRLVLRVALSRSNIEVVAVNDPFITTDYAAYMFKYDSTHGRYAGE--VTHDDKHIIIDGKKIAVHQERDPANLPWGSENIDIAIDSTGVFKELDTAQKHIDAGAKKVVITAPSSTAPMFVVGVNEDKYTSDL 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P1_KLUMA (Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Kluyveromyces marxianus GN=GAP1 PE=1 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 1.677e-31
Identity = 68/142 (47.89%), Postives = 88/142 (61.97%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPE 506
            V I INGFGRIGRLV R+ L+R ++++VA+NDPFI+ DY  YM KYDS HG++K       D   L+   K V VF  ++P  +PW + G +  V+STGVF                V+I+APSK APMFVVGVNE +Y  E
Sbjct:    2 VSIAINGFGRIGRLVLRIALERKNIDVVAINDPFISVDYAAYMFKYDSTHGKYKGE--VSHDGSNLIINGKKVAVFQEKDPATLPWGKLGVDIAVDSTGVFKELDSAQKHIDAGAKKVVITAPSKTAPMFVVGVNEDKYNGE 141          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PC_SCEVA (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic (Fragment) OS=Scenedesmus vacuolatus GN=GapC PE=2 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 4.879e-31
Identity = 70/138 (50.72%), Postives = 88/138 (63.77%), Query Frame = 3
Query:   96 NGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKT-LLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPE 506
            NGFGRIG LV R  L R DV++VA+NDPFI  +YM YM KYDSVHG++   E  V+ DK  +    + +    + +P +IPW E GA+YVVESTGVFT               V+ISAPS DAPMFV+GVN  +Y P+
Sbjct:    1 NGFGRIGSLVLRATLDRKDVKVVAINDPFIEGEYMAYMFKYDSVHGRY---EGDVQGDKHGITINGEQIKTLAMMDPTQIPWGEVGADYVVESTGVFTTVDKCQAHLKGGAKKVVISAPSADAPMFVMGVNADKYDPK 135          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P1_JACOR (Glyceraldehyde-3-phosphate dehydrogenase, muscle OS=Jaculus orientalis PE=1 SV=2)

HSP 1 Score: 133.65 bits (335), Expect = 4.879e-31
Identity = 74/171 (43.27%), Postives = 93/171 (54.39%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKD--------------DKT--------------LLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            VK+G+NGFGRIGRLV R       V++VA+NDPFI  +YM YM KYDS HG++K   + + D              D T              L+     +T+F  R+P +I W + GAEYVVESTGVFT               VIISAPS+DAPMFV+GVN  +Y   L
Sbjct:    2 VKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFKYDSTHGKFKVDIVAINDPFIDLNYMVYMFKYDSTHGKFKGTVKAENGKLVINGHAITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSRDAPMFVMGVNHEKYDKSL 172          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P2_DROPS (Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Drosophila pseudoobscura pseudoobscura GN=Gapdh2 PE=2 SV=2)

HSP 1 Score: 133.265 bits (334), Expect = 6.372e-31
Identity = 72/142 (50.70%), Postives = 88/142 (61.97%), Query Frame = 3
Query:   84 KIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            KIGINGFGRIGRLV R  + +    +VAVNDPFI  +YM Y+ K+DS HG++K       +   L+   + +TVF  R+P  I WA  GAEYVVESTGVFT               V+ISAPS DAPMFV GVN   YKP++
Sbjct:    3 KIGINGFGRIGRLVLRAAIDKG-ASVVAVNDPFIDVNYMVYLFKFDSTHGRFKG--TVAAEGGFLVVNGQKITVFSERDPANINWASAGAEYVVESTGVFTTIEKASTHLKGGAKKVVISAPSADAPMFVCGVNLDAYKPDM 141          
The following BLAST results are available for this feature:
BLAST of FC876224 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 307
Match NameE-valueIdentityDescription
G3P1_TRIKO4.413e-3252.90Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Tric... [more]
G3P1_KLULA5.763e-3249.30Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Kluy... [more]
G3P4_CAEEL7.527e-3250.00Glyceraldehyde-3-phosphate dehydrogenase 4 OS=Caen... [more]
G3P1_CAEEL7.527e-3250.00Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Caen... [more]
G3P2_SCHPO9.830e-3250.71Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Schi... [more]
G3P2_CANGA1.284e-3148.25Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Cand... [more]
G3P1_KLUMA1.677e-3147.89Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Kluy... [more]
G3PC_SCEVA4.879e-3150.72Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3P1_JACOR4.879e-3143.27Glyceraldehyde-3-phosphate dehydrogenase, muscle O... [more]
G3P2_DROPS6.372e-3150.70Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Dros... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32002A02EF DevOvary1 Citrus clementina cDNA clone C32002A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876224 ID=FC876224|Name=FC876224|organism=Citrus clementina|type=EST|length=509bp
GGACTGCTCTCTCTACTCTCTACAACTTTCTTCACCACTCTTTCACCGCT
CAATTTCATCTCTCGAGAATCATGGGGAAGGTCAAGATCGGAATCAACGG
ATTCGGAAGAATTGGTAGGCTGGTGGCAAGAGTCATCTTGCAGAGGGACG
ATGTTGAACTCGTTGCTGTTAATGATCCCTTTATCACAACCGATTACATG
ACATACATGTGTAAGTACGACAGTGTTCACGGTCAATGGAAGCACCATGA
ATTGAAGGTTAAGGACGATAAGACCCTTCTCTTTGGTGAGAAGCCTGTCA
CTGTTTTCGGTGTTAGGAACCCAGAGGAGATCCCATGGGCTGAGACTGGA
GCCGAGTATGTTGTGGAGTCGACTGGAGTCTTTACAGACAAGGATAAGGC
TGCTGCCCATTTGAAGGGTGGTGCTAAGAAAGTTATCATCTCAGCCCCCA
GCAAGGATGCTCCTATGTTTGTTGTGGGTGTCAATGAGCACGAGTACAAA
CCAGAGCTC
back to top