FC876224

Overview
NameFC876224
Unique NameFC876224
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length509
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10322 contig Ccv1_Contig10322:7..515. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_CHLTR (Glyceraldehyde-3-phosphate dehydrogenase OS=Chlamydia trachomatis GN=gap PE=3 SV=3)

HSP 1 Score: 101.293 bits (251), Expect = 2.683e-21
Identity = 57/143 (39.86%), Postives = 84/143 (58.74%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDD-VELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSK-DAPMFVVGVNEHEYKP 503
            ++I INGFGRIGRLV R IL+R+  +E+VA+ND  +  D +TY+ KYDS HG +         D  L+ GE+ V     ++ +++PW +   + VVESTG+F                V+I+AP+K D P FV+GVN  ++ P
Sbjct:    1 MRIVINGFGRIGRLVLRQILKRNSPIEVVAIND-LVAGDLLTYLFKYDSTHGSFAPQ--ATFSDGCLVMGERKVHFLAEKDVQKLPWKDLDVDVVVESTGLFVNRDDVAKHLDSGAKRVLITAPAKGDVPTFVMGVNHQQFDP 140          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_MYCPN (Glyceraldehyde-3-phosphate dehydrogenase OS=Mycoplasma pneumoniae GN=gapA PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 3.505e-21
Identity = 56/135 (41.48%), Postives = 78/135 (57.78%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVN 485
            +++ INGFGRIGRLV R +L + ++E+VAVND     D + ++ KYDS HG++K  +  V  D TL+  +K V VF  ++P  +PWAE   + VVESTG F                VIISAP+K   +  V  N
Sbjct:    8 IRVAINGFGRIGRLVFRALLSQKNIEIVAVND-LTHPDTLAHLLKYDSAHGEFK--KKVVAKDNTLMIDKKKVLVFSEKDPANLPWAEHNIDIVVESTGRFVSEEGASLHLQAGAKRVIISAPAKQKTIKTVVYN 139          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_CHLMU (Glyceraldehyde-3-phosphate dehydrogenase OS=Chlamydia muridarum GN=gap PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 3.505e-21
Identity = 56/143 (39.16%), Postives = 85/143 (59.44%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRD-DVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSK-DAPMFVVGVNEHEYKP 503
            ++I INGFGRIGRLV R IL+R+  +E+VA+ND  ++ D +TY+ KYDS HG +         D  L+ GE+ +     ++ +++PW +   + VVESTG+F                V+I+AP+K D P FV+GVN  ++ P
Sbjct:    1 MRIVINGFGRIGRLVLRQILKRNAPIEVVAIND-LVSGDLLTYLFKYDSTHGSFASQ--ATFSDGCLVVGERKIRFLAEKDVQKLPWKDLDVDVVVESTGLFVNKDDAAKHLDSGAKRVLITAPAKGDVPTFVMGVNHQKFDP 140          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_STRCO (Glyceraldehyde-3-phosphate dehydrogenase OS=Streptomyces coelicolor GN=gap PE=3 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 7.807e-21
Identity = 57/143 (39.86%), Postives = 83/143 (58.04%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRD-DVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPM-FVVGVNEHEYKP 503
            +++GINGFGRIGR   R +L++  D+E+VAVND    T    ++ KYD++ G+ K      +D  T+    K + V   RNP +IPW E G + V+ESTG+FT               V+ISAP+KD  +  V+GVN+ +Y P
Sbjct:    3 IRVGINGFGRIGRNYFRALLEQGADIEIVAVND-LGDTATTAHLLKYDTILGRLKAEVSHTED--TITVDGKTIKVLSERNPADIPWGELGVDIVIESTGIFTKKADAEKHIAGGAKKVLISAPAKDEDITIVMGVNQDKYDP 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_THEMA (Glyceraldehyde-3-phosphate dehydrogenase OS=Thermotoga maritima GN=gap PE=1 SV=2)

HSP 1 Score: 97.8265 bits (242), Expect = 2.967e-20
Identity = 58/145 (40.00%), Postives = 85/145 (58.62%), Query Frame = 3
Query:   84 KIGINGFGRIGRLVARVILQRD--DVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVK-DDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPM-FVVGVNEHEYKPE 506
            ++ INGFGRIGRLV R+I +R   D+E+VA+ND    T  + ++ KYDSVH   K    KV+  + +L+   K + VF   +P ++PW + G ++V+ESTGVF                VII+AP+K   +  V+G NE + KPE
Sbjct:    3 RVAINGFGRIGRLVYRIIYERKNPDIEVVAIND-LTDTKTLAHLLKYDSVH---KKFPGKVEYTENSLIVDGKEIKVFAEPDPSKLPWKDLGVDFVIESTGVFRNREKAELHLQAGAKKVIITAPAKGEDITVVIGCNEDQLKPE 143          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PB_PEA (Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Pisum sativum GN=GAPB PE=2 SV=2)

HSP 1 Score: 97.8265 bits (242), Expect = 2.967e-20
Identity = 58/150 (38.67%), Postives = 88/150 (58.67%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDD--VELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSK--DAPMFVVGVNEHEYKPEL 509
            + K+K+ INGFGRIGR   R    R D  +E++ VND     +  +++ KYDS+ G +K  E+K+ +++T+    KP+ V   R+P ++PWAE G + V+E TGVF                VII+AP+K  D P +V+GVNE +Y  E+
Sbjct:   83 VAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKN-ASHLLKYDSMLGTFKA-EVKILNNETITVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVIGVNEQDYGHEV 230          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PB_SPIOL (Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Spinacia oleracea GN=GAPB PE=1 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 3.875e-20
Identity = 59/146 (40.41%), Postives = 84/146 (57.53%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDD--VELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSK--DAPMFVVGVNEHEY 497
            + K+K+ INGFGRIGR   R    R D  +++V VND        T++ KYDS+ G +K  ++K+ D++T     KP+ V   R+P ++PWAE G + V+E TGVF                VII+AP+K  D P +VVGVNE +Y
Sbjct:   82 VAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKS-ATHLLKYDSILGTFKA-DVKIIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGSDIPTYVVGVNEKDY 225          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P1_BACCE (Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Bacillus cereus GN=gap1 PE=1 SV=3)

HSP 1 Score: 97.4413 bits (241), Expect = 3.875e-20
Identity = 61/141 (43.26%), Postives = 82/141 (58.16%), Query Frame = 3
Query:   84 KIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMT--YMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVV-GVNEHEY 497
            KIGINGFGRIGR V R  L   +VE+VA+ND    TD  T  ++ KYD+VHG   + E+   ++  ++ G K + V   R+P ++PW++ G E VVESTG FT               VIISAP+ D  + VV GVN  +Y
Sbjct:    3 KIGINGFGRIGRNVFRAALNNSEVEVVAIND---LTDAKTLAHLLKYDTVHGTL-NAEVSANENSIVVNG-KEIKVIAERDPAQLPWSDYGVEVVVESTGRFTKKSDAEKHLGGSVKKVIISAPASDEDITVVMGVNHEQY 138          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P2_ANAVT (Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gap2 PE=3 SV=2)

HSP 1 Score: 96.2857 bits (238), Expect = 8.632e-20
Identity = 58/144 (40.28%), Postives = 84/144 (58.33%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDD--VELVAVNDPFITTDYMT--YMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAP-MFVVGVNEHEY 497
            +++ INGFGRIGR  AR  L R++  +ELVAVND   T+D  T  ++ KYDS+ G+ K+ ++   DD ++    K +     RNPE +PW E   + ++ESTGVFT               V+I+AP K+    FV+GVN H+Y
Sbjct:    2 IRVAINGFGRIGRNFARCWLGRENSNIELVAVND---TSDPRTNAHLLKYDSMLGKLKNVDITA-DDNSITVNGKTIKCVSDRNPENLPWKEWEIDLIIESTGVFTSKEGALKHVNAGAKKVLITAPGKNEDGTFVIGVNHHDY 141          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P1_BACSU (Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Bacillus subtilis GN=gapA PE=1 SV=2)

HSP 1 Score: 96.2857 bits (238), Expect = 8.632e-20
Identity = 59/140 (42.14%), Postives = 80/140 (57.14%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPM-FVVGVNEHEY 497
            VK+GINGFGRIGR V R  L   +VE+VAVND     + + ++ +YDSVHG+    E+ V D   L+   K + V   R+P ++ W + G E VVESTG FT               VIISAP+ +  +  V+GVNE +Y
Sbjct:    3 VKVGINGFGRIGRNVFRAALNNPEVEVVAVND-LTDANMLAHLLQYDSVHGK-LDAEVSV-DGNNLVVNGKTIEVSAERDPAKLSWGKQGVEIVVESTGFFTKRADAAKHLEAGAKKVIISAPANEEDITIVMGVNEDKY 139          
The following BLAST results are available for this feature:
BLAST of FC876224 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 307
Match NameE-valueIdentityDescription
G3P_CHLTR2.683e-2139.86Glyceraldehyde-3-phosphate dehydrogenase OS=Chlamy... [more]
G3P_MYCPN3.505e-2141.48Glyceraldehyde-3-phosphate dehydrogenase OS=Mycopl... [more]
G3P_CHLMU3.505e-2139.16Glyceraldehyde-3-phosphate dehydrogenase OS=Chlamy... [more]
G3P_STRCO7.807e-2139.86Glyceraldehyde-3-phosphate dehydrogenase OS=Strept... [more]
G3P_THEMA2.967e-2040.00Glyceraldehyde-3-phosphate dehydrogenase OS=Thermo... [more]
G3PB_PEA2.967e-2038.67Glyceraldehyde-3-phosphate dehydrogenase B, chloro... [more]
G3PB_SPIOL3.875e-2040.41Glyceraldehyde-3-phosphate dehydrogenase B, chloro... [more]
G3P1_BACCE3.875e-2043.26Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Baci... [more]
G3P2_ANAVT8.632e-2040.28Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Anab... [more]
G3P1_BACSU8.632e-2042.14Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Baci... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32002A02EF DevOvary1 Citrus clementina cDNA clone C32002A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876224 ID=FC876224|Name=FC876224|organism=Citrus clementina|type=EST|length=509bp
GGACTGCTCTCTCTACTCTCTACAACTTTCTTCACCACTCTTTCACCGCT
CAATTTCATCTCTCGAGAATCATGGGGAAGGTCAAGATCGGAATCAACGG
ATTCGGAAGAATTGGTAGGCTGGTGGCAAGAGTCATCTTGCAGAGGGACG
ATGTTGAACTCGTTGCTGTTAATGATCCCTTTATCACAACCGATTACATG
ACATACATGTGTAAGTACGACAGTGTTCACGGTCAATGGAAGCACCATGA
ATTGAAGGTTAAGGACGATAAGACCCTTCTCTTTGGTGAGAAGCCTGTCA
CTGTTTTCGGTGTTAGGAACCCAGAGGAGATCCCATGGGCTGAGACTGGA
GCCGAGTATGTTGTGGAGTCGACTGGAGTCTTTACAGACAAGGATAAGGC
TGCTGCCCATTTGAAGGGTGGTGCTAAGAAAGTTATCATCTCAGCCCCCA
GCAAGGATGCTCCTATGTTTGTTGTGGGTGTCAATGAGCACGAGTACAAA
CCAGAGCTC
back to top