FC876224

Overview
NameFC876224
Unique NameFC876224
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length509
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10322 contig Ccv1_Contig10322:7..515. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_STRP1 (Glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus pyogenes serotype M1 GN=gap PE=3 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 5.608e-11
Identity = 40/101 (39.60%), Postives = 59/101 (58.42%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVF 383
            VK+GINGFGRIGRL  R I   + VE+  +ND     + + ++ KYD+  G++    ++VK+    + G   + V   R+PE I WA  G E V+E+TG F
Sbjct:    3 VKVGINGFGRIGRLAFRRIQNIEGVEVTRIND-LTDPNMLAHLLKYDTTQGRF-DGTVEVKEGGFEVNGNF-IKVSAERDPENIDWATDGVEIVLEATGFF 100          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_STREQ (Glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus equisimilis GN=gap PE=3 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 5.608e-11
Identity = 40/101 (39.60%), Postives = 59/101 (58.42%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVF 383
            VK+GINGFGRIGRL  R I   + VE+  +ND     + + ++ KYD+  G++    ++VK+    + G   + V   R+PE I WA  G E V+E+TG F
Sbjct:    3 VKVGINGFGRIGRLAFRRIQNVEGVEVTRIND-LTDPNMLAHLLKYDTTQGRF-DGTVEVKEGGFEVNGNF-IKVSAERDPENIDWATDGVEIVLEATGFF 100          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: E4PD_SHELP (D-erythrose-4-phosphate dehydrogenase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=epd PE=3 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 5.608e-11
Identity = 42/148 (28.38%), Postives = 73/148 (49.32%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQ---RDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSK---DAPMFVVGVNEHEYKPE 506
            +K+ ING+GRIGR + R + +   RD +++VA+N+     + M ++ +YD+ HG+++       D   +  G+  + +    + E++PW     + V E+TG                  V+IS PS    DA + V GVN  + K E
Sbjct:    2 IKVAINGYGRIGRSILRALYESGKRDQIQIVAINE-LANPEAMLHLTQYDTTHGRFQ--SPASLDANVMTIGDDRIQLLHEADAEKLPWRSLDIDIVFEATGALIDRQACEAHIRAGAKQVLISHPSSGDVDATI-VYGVNHQDLKAE 145          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: E4PD_SHEFN (D-erythrose-4-phosphate dehydrogenase OS=Shewanella frigidimarina (strain NCIMB 400) GN=epd PE=3 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 7.324e-11
Identity = 42/147 (28.57%), Postives = 74/147 (50.34%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQ---RDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKD--APMFVVGVNEHEYKPE 506
            +++ ING+GRIGR + R + +   R  +++VA+N+     + + ++ +YD+ HG++K H +K+  D+ LL G+  + +    +   +PWAE   + V E+TG                  V+IS PS        V GVN    + E
Sbjct:    2 IRVAINGYGRIGRSILRALYESGKRQQIQIVAINE-LAKPEAICHLTQYDTTHGRFK-HTVKLNGDQ-LLIGDDSILLLNQPDANLLPWAELDIDIVYEATGSLIDRQACEAHIHAGAKQVLISHPSSADVDETIVYGVNHDLLRAE 145          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: E4PD_SALAR (D-erythrose-4-phosphate dehydrogenase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=epd PE=3 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 7.324e-11
Identity = 45/148 (30.41%), Postives = 78/148 (52.70%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQ---RDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLF-GEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAP-SKDAPMFVV-GVNEHEYKPE 506
            V++ INGFGRIGR V R + +   R ++ +VA+N+       M ++ KYD+ HG++     +V+ ++  LF G+  + +   +   ++PW E G + V++ TGV+                V+ S P S D    VV GVN+++ + E
Sbjct:    3 VRVAINGFGRIGRNVVRALYESGRRAEITVVAINE-LADAAGMAHLLKYDTSHGRF---AWEVRHEREQLFVGDDVIRILHEQTLADLPWRELGVDVVLDCTGVYGNREHGEAHIAAGAKKVLFSHPGSNDLDATVVFGVNQNQLRAE 146          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: E4PD_AERS4 (D-erythrose-4-phosphate dehydrogenase OS=Aeromonas salmonicida (strain A449) GN=epd PE=3 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 7.324e-11
Identity = 43/141 (30.50%), Postives = 77/141 (54.61%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQ--RD-DVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPM---FVVGVN 485
            +KI ING+GRIGR V R + +  RD ++++VA+N+     + M ++ ++D+ HG++++         ++L GE  +++F  ++P  +PW   G + V++ TGVF                V+ S P+ DA +    V GVN
Sbjct:    2 IKIAINGYGRIGRNVLRALYESGRDKNIKIVAINE-LAAPEAMVHLTRFDTSHGRFRYPVQLA--GHSMLVGEDLISLFAEQDPANLPWRALGVDVVLDCTGVFGSRADAELHLGAGAGKVLFSHPA-DADVDATIVYGVN 138          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: E4PD_SHESR (D-erythrose-4-phosphate dehydrogenase OS=Shewanella sp. (strain MR-7) GN=epd PE=3 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 9.566e-11
Identity = 40/147 (27.21%), Postives = 76/147 (51.70%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQ---RDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKD--APMFVVGVNEHEYKPE 506
            +++ ING+GRIGR + R + +   R  +++VA+N+     + + ++ +YD+ HG+++   +K+ DD+ +L G+  + +    +P ++PW E   + V E+TG                  V+IS PS        V GVN+   + E
Sbjct:    2 IRVAINGYGRIGRSILRALYESGKRQQIQIVAINE-LAKPEAIVHLTQYDTTHGRFQPR-VKLVDDQ-MLIGDDVIKILHEPDPAKLPWREMDIDIVYEATGAILDRNSCEAHIHAGAKQVLISHPSSADVDGTIVYGVNQDLLRAE 145          
The following BLAST results are available for this feature:
BLAST of FC876224 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 307
Match NameE-valueIdentityDescription
G3P_STRP15.608e-1139.60Glyceraldehyde-3-phosphate dehydrogenase OS=Strept... [more]
G3P_STREQ5.608e-1139.60Glyceraldehyde-3-phosphate dehydrogenase OS=Strept... [more]
E4PD_SHELP5.608e-1128.38D-erythrose-4-phosphate dehydrogenase OS=Shewanell... [more]
E4PD_SHEFN7.324e-1128.57D-erythrose-4-phosphate dehydrogenase OS=Shewanell... [more]
E4PD_SALAR7.324e-1130.41D-erythrose-4-phosphate dehydrogenase OS=Salmonell... [more]
E4PD_AERS47.324e-1130.50D-erythrose-4-phosphate dehydrogenase OS=Aeromonas... [more]
E4PD_SHESR9.566e-1127.21D-erythrose-4-phosphate dehydrogenase OS=Shewanell... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32002A02EF DevOvary1 Citrus clementina cDNA clone C32002A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876224 ID=FC876224|Name=FC876224|organism=Citrus clementina|type=EST|length=509bp
GGACTGCTCTCTCTACTCTCTACAACTTTCTTCACCACTCTTTCACCGCT
CAATTTCATCTCTCGAGAATCATGGGGAAGGTCAAGATCGGAATCAACGG
ATTCGGAAGAATTGGTAGGCTGGTGGCAAGAGTCATCTTGCAGAGGGACG
ATGTTGAACTCGTTGCTGTTAATGATCCCTTTATCACAACCGATTACATG
ACATACATGTGTAAGTACGACAGTGTTCACGGTCAATGGAAGCACCATGA
ATTGAAGGTTAAGGACGATAAGACCCTTCTCTTTGGTGAGAAGCCTGTCA
CTGTTTTCGGTGTTAGGAACCCAGAGGAGATCCCATGGGCTGAGACTGGA
GCCGAGTATGTTGTGGAGTCGACTGGAGTCTTTACAGACAAGGATAAGGC
TGCTGCCCATTTGAAGGGTGGTGCTAAGAAAGTTATCATCTCAGCCCCCA
GCAAGGATGCTCCTATGTTTGTTGTGGGTGTCAATGAGCACGAGTACAAA
CCAGAGCTC
back to top