FC876224

Overview
NameFC876224
Unique NameFC876224
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length509
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10322 contig Ccv1_Contig10322:7..515. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_CURLU (Glyceraldehyde-3-phosphate dehydrogenase OS=Curvularia lunata GN=GPD PE=3 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 2.116e-34
Identity = 77/143 (53.85%), Postives = 93/143 (65.03%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            VK+GINGFGRIGR+V R  ++ +DVE+VAVNDPFI   Y  YM KYDS HGQ+K  ++KV D   L    K V     ++P  IPW+ETGA YVVESTGVFT               V+ISAPS DAPMFV+GVN   YK ++
Sbjct:    3 VKVGINGFGRIGRIVFRNAIEHNDVEIVAVNDPFIEPHYAAYMLKYDSTHGQFK-GDIKV-DGNNLTVNGKTVRFHMEKDPANIPWSETGAYYVVESTGVFTTTEKAKAHLKGGAKKVVISAPSADAPMFVMGVNHETYKSDI 143          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_TRISI (Glyceraldehyde-3-phosphate dehydrogenase OS=Trionyx sinensis GN=GAPDH PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 2.764e-34
Identity = 74/143 (51.75%), Postives = 94/143 (65.73%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            VKIG+NGFGRIGRLV R     D V++VA+NDPFI  +YM YM KYDS HG++ H  +K ++ K ++ G+  +T+F  R+P  I W + GAEYVVESTGVFT               V+ISAPS DAPMFV+GVN  +Y   L
Sbjct:    2 VKIGVNGFGRIGRLVTRAAFTCDKVQIVAINDPFIDLNYMVYMFKYDSTHGRF-HGTVKAENGKLVINGQ-AITIFQERDPANIKWGDAGAEYVVESTGVFTTTEKASAHLKGGAKRVVISAPSADAPMFVMGVNHEKYDNSL 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_COCP7 (Glyceraldehyde-3-phosphate dehydrogenase OS=Coccidioides posadasii (strain C735) GN=GPD PE=3 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 3.610e-34
Identity = 76/143 (53.15%), Postives = 96/143 (67.13%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            VK+GINGFGRIGR+V R  ++  +VE+VAVNDPFI T Y  YM KYDS HG++K  ++K  ++   + G K V  +  R+P  IPWAETGA+YV+ESTGVFT               VIISAPS DAPMFV+GVN   YK ++
Sbjct:    3 VKVGINGFGRIGRIVFRNAVEHPEVEIVAVNDPFIETHYAAYMLKYDSTHGRFKG-DVKFSENGLDVDG-KHVRFYQERDPANIPWAETGADYVIESTGVFTTTEKASAHLKGGAKKVIISAPSADAPMFVMGVNNETYKSDI 143          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_PANVR (Glyceraldehyde-3-phosphate dehydrogenase OS=Panulirus versicolor PE=1 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 6.157e-34
Identity = 77/142 (54.23%), Postives = 94/142 (66.20%), Query Frame = 3
Query:   84 KIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            KIGINGFGRIGRLV R  L+    ++VAVNDPFI  +YM YM KYDS HG +K  E+K +D   ++ G+K +TVF    PE IPW++ GAEY+VESTGVFT               VIISAPS DAPMFV GVN  +Y  ++
Sbjct:    2 KIGINGFGRIGRLVLRAALEMG-AQVVAVNDPFIALEYMVYMFKYDSTHGMFKG-EVKAEDGALVVDGKK-ITVFNEMKPENIPWSKAGAEYIVESTGVFTTIEKASAHFKGGAKKVIISAPSADAPMFVCGVNLEKYSKDM 140          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_BRUMA (Glyceraldehyde-3-phosphate dehydrogenase OS=Brugia malayi GN=G3PD PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 8.042e-34
Identity = 76/145 (52.41%), Postives = 93/145 (64.14%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKP---VTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEY 497
            M K K+GINGFGRIGRLV R  +++D V++VAVNDPFI  DYM YM KYDS HG++K   +  +  K ++   K    ++V   ++P EIPW   GAEYVVESTGVFT               VIISAPS DAPMFV+GVN   Y
Sbjct:    1 MSKPKVGINGFGRIGRLVLRAAVEKDTVDVVAVNDPFINIDYMVYMFKYDSTHGRFK-GSVSAEGGKLIVTNGKTTHHISVHNSKDPAEIPWGVDGAEYVVESTGVFTTTDKASAHLKGGAKKVIISAPSADAPMFVMGVNNDMY 144          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P1_GLORO (Glyceraldehyde-3-phosphate dehydrogenase 1 (Fragment) OS=Globodera rostochiensis GN=GPD-1 PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 8.042e-34
Identity = 75/150 (50.00%), Postives = 94/150 (62.67%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKP------VTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKP 503
            M K K+GINGFGRIGRL  R  +++D V++VA+NDPFI  DYM YM  YDS HG++     K+      L  EK       + VF +++P EI WAE GAEYV+ESTGVFT               V+ISAPS DAPM+V+GVNE +Y P
Sbjct:    1 MVKPKVGINGFGRIGRLALRAAVEKDTVQVVAINDPFIELDYMVYMFNYDSTHGRFNG---KISTSAGNLVVEKEGKATHTIKVFNLKDPAEIKWAEVGAEYVIESTGVFTTIEKASAHLKGGAKKVVISAPSADAPMYVMGVNEDKYDP 147          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_PHANO (Glyceraldehyde-3-phosphate dehydrogenase OS=Phaeosphaeria nodorum GN=GPD1 PE=3 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 1.050e-33
Identity = 74/143 (51.75%), Postives = 95/143 (66.43%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            VK+GINGFGRIGR+V R  ++ +DVE+VAVNDPFI   Y  YM KYDS HGQ+K  ++KV+ +   + G K +  +  ++P  IPW+ETGA YVVESTGVFT               V+ISAPS DAPMFV+GVN   Y  ++
Sbjct:    3 VKVGINGFGRIGRIVFRNAIEHNDVEIVAVNDPFIEPHYAAYMLKYDSQHGQFK-GDIKVEGNDLTING-KTIRFYTEKDPANIPWSETGAYYVVESTGVFTTTDKAKAHLKGGAKKVVISAPSADAPMFVMGVNNETYTKDI 143          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_LYOSH (Glyceraldehyde-3-phosphate dehydrogenase OS=Lyophyllum shimeji GN=GPD PE=3 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 1.050e-33
Identity = 74/142 (52.11%), Postives = 93/142 (65.49%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPE 506
            V +GINGFGRIGR+V R  L    +++VA+NDPFI  +YM YM KYDSVHG++K   ++ KD K  + G KPV V+G +NP +I W   G +YVVESTGVFT               VIISAPS DAPMFV+G N  +Y P+
Sbjct:    2 VNVGINGFGRIGRIVFRNALLNPKIQVVAINDPFINLEYMVYMFKYDSVHGRFKG-TVEAKDGKLWIQG-KPVIVYGEKNPSDIKWGAAGRDYVVESTGVFTTVEKAEGHLKGGAKKVIISAPSADAPMFVMGCNLDQYDPK 141          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_COLLN (Glyceraldehyde-3-phosphate dehydrogenase OS=Colletotrichum lindemuthianum GN=GPDA PE=3 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 1.050e-33
Identity = 75/142 (52.82%), Postives = 89/142 (62.68%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEY 497
            M  +K+GINGFGRIGR+V R  ++  DVE+VAVNDPFI T Y  YM KYDS HG +       +D   L+   K V  +  R+P  IPW ETGA+YVVESTGVFT               VIISAPS DAPM+V+GVNE  Y
Sbjct:    1 MAPIKVGINGFGRIGRIVFRNAVEHPDVEIVAVNDPFIETKYAAYMLKYDSTHGIFNGE--IAQDGNDLVINGKKVKFYTERDPAVIPWKETGADYVVESTGVFTTIDKAKAHLQGGAKKVIISAPSADAPMYVMGVNEKSY 140          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_PLESA (Glyceraldehyde-3-phosphate dehydrogenase OS=Pleurotus sajor-caju GN=GPD PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 1.372e-33
Identity = 75/142 (52.82%), Postives = 94/142 (66.20%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPE 506
            V +GINGFGRIGR+V R  L+   V++VA+NDPFI  DYM YM KYDSVHG++K   ++ KD K ++ G KP+ +F  ++P  IPW   GA+YVVESTGVFT               V+ISAPS DAPMFV GVN   Y P+
Sbjct:    2 VNVGINGFGRIGRIVFRNALEVGGVDVVAINDPFIDLDYMVYMFKYDSVHGRFK-GSIEAKDGKLIVEG-KPIHIFAEKDPANIPWGSVGADYVVESTGVFT-TIDKASAHLKGGEKVVISAPSADAPMFVCGVNLETYDPK 140          
The following BLAST results are available for this feature:
BLAST of FC876224 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 307
Match NameE-valueIdentityDescription
G3P_CURLU2.116e-3453.85Glyceraldehyde-3-phosphate dehydrogenase OS=Curvul... [more]
G3P_TRISI2.764e-3451.75Glyceraldehyde-3-phosphate dehydrogenase OS=Triony... [more]
G3P_COCP73.610e-3453.15Glyceraldehyde-3-phosphate dehydrogenase OS=Coccid... [more]
G3P_PANVR6.157e-3454.23Glyceraldehyde-3-phosphate dehydrogenase OS=Panuli... [more]
G3P_BRUMA8.042e-3452.41Glyceraldehyde-3-phosphate dehydrogenase OS=Brugia... [more]
G3P1_GLORO8.042e-3450.00Glyceraldehyde-3-phosphate dehydrogenase 1 (Fragme... [more]
G3P_PHANO1.050e-3351.75Glyceraldehyde-3-phosphate dehydrogenase OS=Phaeos... [more]
G3P_LYOSH1.050e-3352.11Glyceraldehyde-3-phosphate dehydrogenase OS=Lyophy... [more]
G3P_COLLN1.050e-3352.82Glyceraldehyde-3-phosphate dehydrogenase OS=Collet... [more]
G3P_PLESA1.372e-3352.82Glyceraldehyde-3-phosphate dehydrogenase OS=Pleuro... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32002A02EF DevOvary1 Citrus clementina cDNA clone C32002A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876224 ID=FC876224|Name=FC876224|organism=Citrus clementina|type=EST|length=509bp
GGACTGCTCTCTCTACTCTCTACAACTTTCTTCACCACTCTTTCACCGCT
CAATTTCATCTCTCGAGAATCATGGGGAAGGTCAAGATCGGAATCAACGG
ATTCGGAAGAATTGGTAGGCTGGTGGCAAGAGTCATCTTGCAGAGGGACG
ATGTTGAACTCGTTGCTGTTAATGATCCCTTTATCACAACCGATTACATG
ACATACATGTGTAAGTACGACAGTGTTCACGGTCAATGGAAGCACCATGA
ATTGAAGGTTAAGGACGATAAGACCCTTCTCTTTGGTGAGAAGCCTGTCA
CTGTTTTCGGTGTTAGGAACCCAGAGGAGATCCCATGGGCTGAGACTGGA
GCCGAGTATGTTGTGGAGTCGACTGGAGTCTTTACAGACAAGGATAAGGC
TGCTGCCCATTTGAAGGGTGGTGCTAAGAAAGTTATCATCTCAGCCCCCA
GCAAGGATGCTCCTATGTTTGTTGTGGGTGTCAATGAGCACGAGTACAAA
CCAGAGCTC
back to top