FC876224

Overview
NameFC876224
Unique NameFC876224
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length509
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10322 contig Ccv1_Contig10322:7..515. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_CANFA (Glyceraldehyde-3-phosphate dehydrogenase OS=Canis familiaris GN=GAPDH PE=2 SV=3)

HSP 1 Score: 140.969 bits (354), Expect = 3.056e-33
Identity = 72/143 (50.35%), Postives = 93/143 (65.03%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            VK+G+NGFGRIGRLV R       V++VA+NDPFI  +YM YM +YDS HG++ H  +K ++ K ++ G K +++F  R+P  I W + GAEYVVESTGVFT               VIISAPS DAPMFV+GVN  +Y   L
Sbjct:    2 VKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKF-HGTVKAENGKLVING-KSISIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSL 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_AJECA (Glyceraldehyde-3-phosphate dehydrogenase OS=Ajellomyces capsulata GN=GPD PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 3.056e-33
Identity = 76/143 (53.15%), Postives = 91/143 (63.64%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            VK+GINGFGRIGR+V R  ++  +V +VAVNDPFI T Y  YM KYDS HGQ+K   + V  +   + G K VT +  R+P  IPW + G EYVVESTGVFT               VIISAPS DAPMFV+GVNE  Y P +
Sbjct:    3 VKVGINGFGRIGRIVFRNAIEHGEVNVVAVNDPFIETHYAAYMLKYDSTHGQFK-GTIDVNSNGLTVNG-KAVTFYQERDPASIPWGKHGVEYVVESTGVFTTTEKASAHLKGGAKKVIISAPSADAPMFVMGVNEKTYDPSV 143          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_XENLA (Glyceraldehyde-3-phosphate dehydrogenase OS=Xenopus laevis GN=gapdh PE=2 SV=2)

HSP 1 Score: 140.584 bits (353), Expect = 3.991e-33
Identity = 74/143 (51.75%), Postives = 92/143 (64.34%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            VK+GINGFG IGRLV R       V++VA+NDPFI  DYM YM KYDS HG++K   +K ++ K L+  ++ +TVF  R+P  I W + GA YVVESTGVFT               V+ISAPS DAPMFVVGVN  +Y+  L
Sbjct:    2 VKVGINGFGCIGRLVTRAAFDSGKVQVVAINDPFIDLDYMVYMFKYDSTHGRFKG-TVKAENGK-LIINDQVITVFQERDPSSIKWGDAGAVYVVESTGVFTTTEKASLHLKGGAKRVVISAPSADAPMFVVGVNHEKYENSL 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_COTJA (Glyceraldehyde-3-phosphate dehydrogenase OS=Coturnix coturnix japonica GN=GAPDH PE=2 SV=2)

HSP 1 Score: 140.584 bits (353), Expect = 3.991e-33
Identity = 73/143 (51.05%), Postives = 92/143 (64.34%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            VK+G+NGFGRIGRLV R  +    V++VA+NDPFI  +YM YM KYDS HG +K   +K ++ K ++ G   +T+F  R+P  I W + GAEYVVESTGVFT               VIISAPS DAPMFV+GVN  +Y   L
Sbjct:    2 VKVGVNGFGRIGRLVTRAAVLSGKVQVVAINDPFIDLNYMVYMFKYDSTHGHFK-GTVKAENGKLVING-NAITIFQERDPSNIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDKSL 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P3_CAEBR (Glyceraldehyde-3-phosphate dehydrogenase 3 OS=Caenorhabditis briggsae GN=gpd-3 PE=3 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 3.991e-33
Identity = 76/149 (51.01%), Postives = 94/149 (63.09%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWK---HHE----LKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEY 497
            M K  +GINGFGRIGRLV R  +++D V +VAVNDPFI+ DYM Y+ +YDS HG++K    HE    L  K+ K+    +  + V+  R+P EI W   GA+YVVESTGVFT               VIISAPS DAPMFVVGVN  +Y
Sbjct:    1 MSKPSVGINGFGRIGRLVLRAAVEKDSVNVVAVNDPFISIDYMVYLFQYDSTHGRFKGTVAHEGDYLLVAKEGKS----QHKIKVYNSRDPAEIQWGSAGADYVVESTGVFTTIEKANAHLKGGAKKVIISAPSADAPMFVVGVNHEKY 145          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_CRYPA (Glyceraldehyde-3-phosphate dehydrogenase OS=Cryphonectria parasitica PE=3 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 5.213e-33
Identity = 75/139 (53.96%), Postives = 88/139 (63.31%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEY 497
            VK+GINGFGRIGR+V R   +  DVE+VAVNDPFI   Y  YM KYDS HG +K        D  L+ G K V  +  R+P  IPW+ETGA+Y+VESTGVFT               VIISAPS DAPM+V+GVNE  Y
Sbjct:    3 VKVGINGFGRIGRIVFRNAHEHSDVEIVAVNDPFIEPHYAAYMLKYDSQHGNFKGDVTVEGSD--LVVGGKKVRFYTERDPAAIPWSETGADYIVESTGVFTTTEKAKAHLKGGAKKVIISAPSADAPMYVMGVNEKTY 139          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P1_RHIRA (Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Rhizomucor racemosus GN=GPD1 PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 5.213e-33
Identity = 74/142 (52.11%), Postives = 90/142 (63.38%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPE 506
            V++GINGFGRIGR+V R      DV++VA+NDPFI  DYM YM KYD+VHG++    ++ KD K ++ G   + V   R+P  IPW   GA+YVVESTGVFT               VIISAPS DAPMFV GVN   YK E
Sbjct:    3 VQVGINGFGRIGRIVLRATESNKDVQVVAINDPFIPLDYMVYMLKYDTVHGRF-DGSVEAKDGKLVVNGH-AIAVSAERDPTSIPWGSAGADYVVESTGVFTTTEAASAHLKGGAKKVIISAPSADAPMFVCGVNLEAYKSE 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_ASPOR (Glyceraldehyde-3-phosphate dehydrogenase OS=Aspergillus oryzae GN=gpdA PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 6.808e-33
Identity = 73/146 (50.00%), Postives = 93/146 (63.70%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            M   K+GINGFGRIGR+V R  +   DV++VAVNDPFI T Y  YM KYDS HG+++   ++  D+  ++ G+K +  F  R+P  IPW   GA Y+VESTGVFT               VIISAPS DAPMFV+GVN  EYK ++
Sbjct:    1 MATPKVGINGFGRIGRIVFRNAIASGDVDVVAVNDPFIETHYAAYMLKYDSTHGRFQG-TIETYDEGLIVNGKK-IRFFAERDPAAIPWGSAGAAYIVESTGVFTTTEKASAHLKGGAKKVIISAPSADAPMFVMGVNNKEYKTDI 144          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P3_CAEEL (Glyceraldehyde-3-phosphate dehydrogenase 3 OS=Caenorhabditis elegans GN=gpd-3 PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 6.808e-33
Identity = 76/149 (51.01%), Postives = 95/149 (63.76%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWK---HHE----LKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEY 497
            M K  +GINGFGRIGRLV R  +++D V +VAVNDPFI+ DYM Y+ +YDS HG++K    HE    L  K+ K+    +  + V+  R+P EI W  +GA+YVVESTGVFT               VIISAPS DAPMFVVGVN  +Y
Sbjct:    1 MTKPSVGINGFGRIGRLVLRAAVEKDSVNVVAVNDPFISIDYMVYLFQYDSTHGRFKGTVAHEGDYLLVAKEGKS----QHKIKVYNSRDPAEIQWGASGADYVVESTGVFTTIEKANAHLKGGAKKVIISAPSADAPMFVVGVNHEKY 145          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P2_CAEEL (Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Caenorhabditis elegans GN=gpd-2 PE=1 SV=2)

HSP 1 Score: 139.813 bits (351), Expect = 6.808e-33
Identity = 76/149 (51.01%), Postives = 95/149 (63.76%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWK---HHE----LKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEY 497
            M K  +GINGFGRIGRLV R  +++D V +VAVNDPFI+ DYM Y+ +YDS HG++K    HE    L  K+ K+    +  + V+  R+P EI W  +GA+YVVESTGVFT               VIISAPS DAPMFVVGVN  +Y
Sbjct:    1 MPKPSVGINGFGRIGRLVLRAAVEKDSVNVVAVNDPFISIDYMVYLFQYDSTHGRFKGTVAHEGDYLLVAKEGKS----QHKIKVYNSRDPAEIQWGASGADYVVESTGVFTTIEKANAHLKGGAKKVIISAPSADAPMFVVGVNHEKY 145          
The following BLAST results are available for this feature:
BLAST of FC876224 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 307
Match NameE-valueIdentityDescription
G3P_CANFA3.056e-3350.35Glyceraldehyde-3-phosphate dehydrogenase OS=Canis ... [more]
G3P_AJECA3.056e-3353.15Glyceraldehyde-3-phosphate dehydrogenase OS=Ajello... [more]
G3P_XENLA3.991e-3351.75Glyceraldehyde-3-phosphate dehydrogenase OS=Xenopu... [more]
G3P_COTJA3.991e-3351.05Glyceraldehyde-3-phosphate dehydrogenase OS=Coturn... [more]
G3P3_CAEBR3.991e-3351.01Glyceraldehyde-3-phosphate dehydrogenase 3 OS=Caen... [more]
G3P_CRYPA5.213e-3353.96Glyceraldehyde-3-phosphate dehydrogenase OS=Crypho... [more]
G3P1_RHIRA5.213e-3352.11Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Rhiz... [more]
G3P_ASPOR6.808e-3350.00Glyceraldehyde-3-phosphate dehydrogenase OS=Asperg... [more]
G3P3_CAEEL6.808e-3351.01Glyceraldehyde-3-phosphate dehydrogenase 3 OS=Caen... [more]
G3P2_CAEEL6.808e-3351.01Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Caen... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32002A02EF DevOvary1 Citrus clementina cDNA clone C32002A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876224 ID=FC876224|Name=FC876224|organism=Citrus clementina|type=EST|length=509bp
GGACTGCTCTCTCTACTCTCTACAACTTTCTTCACCACTCTTTCACCGCT
CAATTTCATCTCTCGAGAATCATGGGGAAGGTCAAGATCGGAATCAACGG
ATTCGGAAGAATTGGTAGGCTGGTGGCAAGAGTCATCTTGCAGAGGGACG
ATGTTGAACTCGTTGCTGTTAATGATCCCTTTATCACAACCGATTACATG
ACATACATGTGTAAGTACGACAGTGTTCACGGTCAATGGAAGCACCATGA
ATTGAAGGTTAAGGACGATAAGACCCTTCTCTTTGGTGAGAAGCCTGTCA
CTGTTTTCGGTGTTAGGAACCCAGAGGAGATCCCATGGGCTGAGACTGGA
GCCGAGTATGTTGTGGAGTCGACTGGAGTCTTTACAGACAAGGATAAGGC
TGCTGCCCATTTGAAGGGTGGTGCTAAGAAAGTTATCATCTCAGCCCCCA
GCAAGGATGCTCCTATGTTTGTTGTGGGTGTCAATGAGCACGAGTACAAA
CCAGAGCTC
back to top