FC876224

Overview
NameFC876224
Unique NameFC876224
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length509
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10322 contig Ccv1_Contig10322:7..515. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_PIG (Glyceraldehyde-3-phosphate dehydrogenase OS=Sus scrofa GN=GAPDH PE=1 SV=4)

HSP 1 Score: 139.428 bits (350), Expect = 8.891e-33
Identity = 72/143 (50.35%), Postives = 91/143 (63.64%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            VK+G+NGFGRIGRLV R       V++VA+NDPFI   YM YM +YDS HG++ H  +K ++ K ++ G K +T+F  R+P  I W + GA YVVESTGVFT               VIISAPS DAPMFV+GVN  +Y   L
Sbjct:    2 VKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLHYMVYMFQYDSTHGKF-HGTVKAENGKLVING-KAITIFQERDPANIKWGDAGATYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSL 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_ONCMY (Glyceraldehyde-3-phosphate dehydrogenase OS=Oncorhynchus mykiss GN=gapdh PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 8.891e-33
Identity = 72/144 (50.00%), Postives = 95/144 (65.97%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKP 503
            M  + +GINGFGRIGRLV R  LQ+  +++VA+NDPFI   YM YM KYDS HG++K  E+ ++D K L+  +  ++VF    P EIPW + GA+YVVESTGVF                V++SAPS DAPMFV+GVNE ++ P
Sbjct:    1 MSDLCVGINGFGRIGRLVLRACLQKG-IKVVAINDPFIDLQYMVYMFKYDSTHGRYKG-EVSMEDGK-LIVDDHSISVFQCMKPHEIPWGKAGADYVVESTGVFLSIDKASSHIQGGAKRVVVSAPSPDAPMFVMGVNEDKFDP 141          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P2_RHIRA (Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Rhizomucor racemosus GN=GPD2 PE=3 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 8.891e-33
Identity = 73/142 (51.41%), Postives = 94/142 (66.20%), Query Frame = 3
Query:   84 KIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            ++GINGFGRIGR+V R  L   +V++VA+NDPFI  +YM YM KYDSVHG+++   ++ KD K ++ G K ++VF  R+P +IPW    A YVVESTGVFT               VIISAPS DAPMFV GVN  +Y  +L
Sbjct:    4 QVGINGFGRIGRIVLRASLSNPEVQVVAINDPFIPLEYMVYMFKYDSVHGRFQ-GTVEAKDGKLVVNG-KEISVFSERDPAQIPWGSVEAAYVVESTGVFTSIDAASAHLQGGAKKVIISAPSGDAPMFVCGVNLEKYTSDL 143          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_SORMA (Glyceraldehyde-3-phosphate dehydrogenase OS=Sordaria macrospora GN=GPD PE=3 SV=2)

HSP 1 Score: 139.043 bits (349), Expect = 1.161e-32
Identity = 71/139 (51.08%), Postives = 92/139 (66.19%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEY 497
            VK+GINGFGRIGR+V R  ++ DD+++VAVNDPFI   Y  YM +YDS HG +K   + V+    ++ G+K V  +  R+P  IPW+ETGA+Y+VESTGVFT               VIISAPS DAPM+V+GVN   Y
Sbjct:    3 VKVGINGFGRIGRIVFRNAIEHDDIQIVAVNDPFIEPKYAEYMLRYDSTHGNFK-GTIAVEGSDLVVNGKK-VKFYTERDPSAIPWSETGADYIVESTGVFTTTEKASAHLKGGAKKVIISAPSADAPMYVMGVNNESY 139          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_LENED (Glyceraldehyde-3-phosphate dehydrogenase OS=Lentinula edodes GN=gpd PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.161e-32
Identity = 74/139 (53.24%), Postives = 92/139 (66.19%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEY 497
            VK+GINGFGRIGR+V R  L   +V +VAVNDPFI  +YM YM KYDSVHG++K   ++ K  K ++ G K ++VFG ++   IPW+  GAEY+VESTGVFT               VIISAPS DAPM+V GVN   Y
Sbjct:    3 VKVGINGFGRIGRIVLRNALLNPEVNVVAVNDPFIALEYMVYMFKYDSVHGRFK-GTVETKGGKLIVDG-KEISVFGEKDAGAIPWSSVGAEYIVESTGVFTTIEKASAHLKGGAKKVIISAPSADAPMYVCGVNLDSY 139          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_BOVIN (Glyceraldehyde-3-phosphate dehydrogenase OS=Bos taurus GN=GAPDH PE=1 SV=4)

HSP 1 Score: 139.043 bits (349), Expect = 1.161e-32
Identity = 72/143 (50.35%), Postives = 92/143 (64.34%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            VK+G+NGFGRIGRLV R       V++VA+NDPFI   YM YM +YDS HG++ +  +K ++ K ++ G K +T+F  R+P  I W + GAEYVVESTGVFT               VIISAPS DAPMFV+GVN  +Y   L
Sbjct:    2 VKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLHYMVYMFQYDSTHGKF-NGTVKAENGKLVING-KAITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYNNTL 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P1_SCHPO (Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Schizosaccharomyces pombe GN=tdh1 PE=1 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.161e-32
Identity = 70/140 (50.00%), Postives = 94/140 (67.14%), Query Frame = 3
Query:   84 KIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKP 503
            K+GINGFGRIGR+V R  L    +++VA+NDPFI  +YM YM KYDS HG++    +++KD K ++ G   + V   R+P +I W+ +GA+YV+ESTGVFT               VIISAPSKDAPM+VVGVNE ++ P
Sbjct:    5 KVGINGFGRIGRIVLRNALVAKTIQVVAINDPFIDLEYMAYMFKYDSTHGRFDG-SVEIKDGKLVIDGNA-IDVHNERDPADIKWSTSGADYVIESTGVFTTQETASAHLKGGAKRVIISAPSKDAPMYVVGVNEEKFNP 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_PICCI (Glyceraldehyde-3-phosphate dehydrogenase OS=Pichia ciferrii GN=GPD PE=3 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 1.517e-32
Identity = 67/143 (46.85%), Postives = 95/143 (66.43%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            + +GINGFGRIGRLV R+ L R D+++VA+NDPFI  +Y +YM KYDS HG++   E+  + +  ++ G+K + V+  R+P  IPW + G +YV++STGVF                V+I+APS  APMFVVGVNE +Y P+L
Sbjct:    3 ITVGINGFGRIGRLVLRIALSRKDIQIVAINDPFIAPEYASYMFKYDSTHGRYS-GEVSHEGENIVIDGKK-IRVYQERDPVNIPWGKDGVDYVIDSTGVFKELDSAQKHIDAGAKKVVITAPSSTAPMFVVGVNEDKYTPDL 143          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_COLGL (Glyceraldehyde-3-phosphate dehydrogenase OS=Colletotrichum gloeosporioides GN=GPDA PE=2 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 1.517e-32
Identity = 74/142 (52.11%), Postives = 92/142 (64.79%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEY 497
            M  +K+GINGFGRIGR+V R  ++  +VE+VAVNDPFI T Y  YM KYDS HG + + E+K ++   L+   K V  +  R+P  IPW ETGA+YVVESTGVFT               VIISAPS DAPM+V+ VNE  Y
Sbjct:    1 MAPIKVGINGFGRIGRIVFRNAIEHPEVEIVAVNDPFIETKYAAYMLKYDSTHGIF-NGEIK-QEGNDLVINGKTVKFYTERDPAAIPWKETGADYVVESTGVFTTTDKAKAHLQGGAKKVIISAPSADAPMYVMVVNEKSY 140          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_PODAN (Glyceraldehyde-3-phosphate dehydrogenase OS=Podospora anserina GN=GPD PE=3 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 1.981e-32
Identity = 74/139 (53.24%), Postives = 90/139 (64.75%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEY 497
            VK+GINGFGRIGR+V R  ++  DVE+VAVNDPFI   Y  YM KYDS HG +K   ++V     ++ G K V  +  R+P  IPW +TGAEY+VESTGVFT               VIISAPS DAPM+V+GVNE  Y
Sbjct:    3 VKVGINGFGRIGRIVFRNAVEHPDVEIVAVNDPFIEPKYAEYMLKYDSTHGVFK-GTIQVSGSDLIVNG-KTVKFYTERDPSAIPWKDTGAEYIVESTGVFTTTEKASAHLKGGAKRVIISAPSADAPMYVMGVNEKTY 139          
The following BLAST results are available for this feature:
BLAST of FC876224 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 307
Match NameE-valueIdentityDescription
G3P_PIG8.891e-3350.35Glyceraldehyde-3-phosphate dehydrogenase OS=Sus sc... [more]
G3P_ONCMY8.891e-3350.00Glyceraldehyde-3-phosphate dehydrogenase OS=Oncorh... [more]
G3P2_RHIRA8.891e-3351.41Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Rhiz... [more]
G3P_SORMA1.161e-3251.08Glyceraldehyde-3-phosphate dehydrogenase OS=Sordar... [more]
G3P_LENED1.161e-3253.24Glyceraldehyde-3-phosphate dehydrogenase OS=Lentin... [more]
G3P_BOVIN1.161e-3250.35Glyceraldehyde-3-phosphate dehydrogenase OS=Bos ta... [more]
G3P1_SCHPO1.161e-3250.00Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Schi... [more]
G3P_PICCI1.517e-3246.85Glyceraldehyde-3-phosphate dehydrogenase OS=Pichia... [more]
G3P_COLGL1.517e-3252.11Glyceraldehyde-3-phosphate dehydrogenase OS=Collet... [more]
G3P_PODAN1.981e-3253.24Glyceraldehyde-3-phosphate dehydrogenase OS=Podosp... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32002A02EF DevOvary1 Citrus clementina cDNA clone C32002A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876224 ID=FC876224|Name=FC876224|organism=Citrus clementina|type=EST|length=509bp
GGACTGCTCTCTCTACTCTCTACAACTTTCTTCACCACTCTTTCACCGCT
CAATTTCATCTCTCGAGAATCATGGGGAAGGTCAAGATCGGAATCAACGG
ATTCGGAAGAATTGGTAGGCTGGTGGCAAGAGTCATCTTGCAGAGGGACG
ATGTTGAACTCGTTGCTGTTAATGATCCCTTTATCACAACCGATTACATG
ACATACATGTGTAAGTACGACAGTGTTCACGGTCAATGGAAGCACCATGA
ATTGAAGGTTAAGGACGATAAGACCCTTCTCTTTGGTGAGAAGCCTGTCA
CTGTTTTCGGTGTTAGGAACCCAGAGGAGATCCCATGGGCTGAGACTGGA
GCCGAGTATGTTGTGGAGTCGACTGGAGTCTTTACAGACAAGGATAAGGC
TGCTGCCCATTTGAAGGGTGGTGCTAAGAAAGTTATCATCTCAGCCCCCA
GCAAGGATGCTCCTATGTTTGTTGTGGGTGTCAATGAGCACGAGTACAAA
CCAGAGCTC
back to top