FC876224

Overview
NameFC876224
Unique NameFC876224
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length509
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10322 contig Ccv1_Contig10322:7..515. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P2_CAEBR (Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Caenorhabditis briggsae GN=gpd-2 PE=3 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 1.981e-32
Identity = 73/146 (50.00%), Postives = 93/146 (63.70%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGE----KPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEY 497
            M K  +GINGFGRIGRLV R  +++D V +VAVNDPFI+ DYM Y+ +YDS HG++K   +K + D  ++  E      + V+  ++P EI W   GA+YVVESTGVFT               VIISAPS DAPMFVVGVN  +Y
Sbjct:    1 MSKPTVGINGFGRIGRLVLRAAVEKDSVNVVAVNDPFISIDYMVYLFQYDSTHGRFK-GTVKHEGDYLIVANEGKSQHKIKVYNSKDPAEIQWGAAGADYVVESTGVFTTIEKANAHLKGGAKKVIISAPSADAPMFVVGVNHEKY 145          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_USTMA (Glyceraldehyde-3-phosphate dehydrogenase OS=Ustilago maydis GN=GAPD PE=3 SV=2)

HSP 1 Score: 137.502 bits (345), Expect = 3.379e-32
Identity = 71/145 (48.97%), Postives = 91/145 (62.76%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPE 506
            M +V IGINGFGRIGR+V R  +  +   +VA+NDPFI  +YM YM KYDS HG + + ++  KD K ++ G K + VF  ++P  IPW + GA YVVESTGVFT               V+ISAPS DAPM+V GVN   Y P+
Sbjct:    1 MSQVNIGINGFGRIGRIVFRNSVVHNTANVVAINDPFIDLEYMVYMLKYDSTHGVF-NGDISTKDGKLIVNG-KSIAVFAEKDPSNIPWGQAGAHYVVESTGVFTTIDKASAHIKGGAKKVVISAPSADAPMYVCGVNLDAYDPK 143          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_NEUCR (Glyceraldehyde 3-phosphate-dehydrogenase OS=Neurospora crassa GN=gpd-1 PE=2 SV=2)

HSP 1 Score: 137.502 bits (345), Expect = 3.379e-32
Identity = 71/139 (51.08%), Postives = 90/139 (64.75%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEY 497
            VK+GINGFGRIGR+V R  ++ DD+ +VAVNDPFI   Y  YM +YD+ HG +K   ++V D   L+   K V  +  R+P  IPW+ETGA+Y+VESTGVFT               VIISAPS DAPM+V+GVN   Y
Sbjct:    3 VKVGINGFGRIGRIVFRNAIEHDDIHIVAVNDPFIEPKYAAYMLRYDTTHGNFK-GTIEV-DGADLVVNGKKVKFYTERDPAAIPWSETGADYIVESTGVFTTTEKASAHLKGGAKKVIISAPSADAPMYVMGVNNETY 139          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_GLOMM (Glyceraldehyde-3-phosphate dehydrogenase OS=Glossina morsitans morsitans GN=Gapdh PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 3.379e-32
Identity = 75/142 (52.82%), Postives = 88/142 (61.97%), Query Frame = 3
Query:   84 KIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            KIGINGFGRIGRLV R  L +   E+VAVNDPFI  +YM Y+ KYDS HG++K       D   L+   K +TVF  R+P  I WA  GAEY+VESTGVFT               V+ISAPS DAPMFV GVN   Y P++
Sbjct:    3 KIGINGFGRIGRLVLRAALDKG-AEVVAVNDPFIDVNYMVYLFKYDSTHGRFKG--TVAADGGFLVVNGKKITVFCERDPTNINWASAGAEYIVESTGVFTTIDKASAHFKGGAKKVVISAPSADAPMFVCGVNLEAYSPDM 141          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_ASPNG (Glyceraldehyde-3-phosphate dehydrogenase OS=Aspergillus niger GN=gpdA PE=3 SV=2)

HSP 1 Score: 137.502 bits (345), Expect = 3.379e-32
Identity = 70/142 (49.30%), Postives = 92/142 (64.79%), Query Frame = 3
Query:   84 KIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            K+GINGFGRIGR+V R  +   +V++VAVNDPFI T Y  YM KYDS HGQ+K   ++  ++  ++ G+K +  F  R+P  IPW  TGA+Y+VESTGVFT               V+ISAPS DAPMFV+GVN   Y  ++
Sbjct:    4 KVGINGFGRIGRIVFRNAINHGEVDVVAVNDPFIETHYAAYMLKYDSTHGQFK-GTIETYEEGLIVNGKK-IRFFAERDPAAIPWGTTGADYIVESTGVFTTQEKAAAHLKGGAKKVVISAPSADAPMFVMGVNNTSYTKDI 143          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PT_DANRE (Glyceraldehyde 3-phosphate dehydrogenase, testis-specific OS=Danio rerio GN=gapdhs PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 3.379e-32
Identity = 71/144 (49.31%), Postives = 95/144 (65.97%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKP 503
            M ++ +GINGFGRIGRLV R  LQ+  +++ A+NDPFI   YM YM KYDS HG++K  E+ ++D K ++ G+  ++VF    P EIPW + GA YVVESTGVF                V++SAPS DAPMFV+GVN+ +Y P
Sbjct:    1 MSELCVGINGFGRIGRLVLRACLQKG-IKVTAINDPFIDLQYMVYMFKYDSTHGRYK-GEVHMEDGKLIVDGQ-AISVFQCMKPAEIPWGDAGALYVVESTGVFLSIEKASAHIQGGAKRVVVSAPSPDAPMFVMGVNQDKYDP 141          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_TRIAT (Glyceraldehyde-3-phosphate dehydrogenase OS=Trichoderma atroviride GN=gpd1 PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 4.413e-32
Identity = 70/139 (50.36%), Postives = 92/139 (66.19%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEY 497
            +K+GINGFGRIGR++    L++ ++ +VAVNDPFI   Y  YM KYDS HG +K  +++V D + L+   KP+  +  R+P  I W+ETGAEY+VESTGVFT               VIISAPS DAPMFV+GVN  +Y
Sbjct:    3 IKVGINGFGRIGRILLSNALEKPELSVVAVNDPFIEPTYAAYMLKYDSSHGLFKG-DIEV-DGQNLVVNGKPIRFYSERDPANIKWSETGAEYIVESTGVFTTIDKAKAHLNGGAKKVIISAPSADAPMFVMGVNHKDY 139          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_RHIMI (Glyceraldehyde-3-phosphate dehydrogenase OS=Rhizomucor miehei GN=GPD PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 4.413e-32
Identity = 76/143 (53.15%), Postives = 94/143 (65.73%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            VK GINGFGRIGR+V R  L   +VE+VA+NDPFI  +YM YM KYDS HG++K   ++ KD K ++ G KP++V+  R+P  IP    GAEY+VESTGVFT               VIISAPS DAPMFVVGVN   Y  ++
Sbjct:    3 VKAGINGFGRIGRIVLRASLLNPEVEVVAINDPFIDLEYMVYMFKYDSTHGRFK-GTVEAKDGKLVVNG-KPISVYAERDPCCIP-GRIGAEYIVESTGVFTTKEKAGAHLTGGAKKVIISAPSADAPMFVVGVNLESYSSDM 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_EMENI (Glyceraldehyde-3-phosphate dehydrogenase OS=Emericella nidulans GN=gpdA PE=1 SV=2)

HSP 1 Score: 137.117 bits (344), Expect = 4.413e-32
Identity = 71/142 (50.00%), Postives = 92/142 (64.79%), Query Frame = 3
Query:   84 KIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            K+GINGFGRIGR+V R  ++   V++VAVNDPFI T Y  YM KYDS HGQ+K   ++  D+  ++ G+K +     R+P  IPW + GAEY+VESTGVFT               V+ISAPS DAPMFV+GVN   YK ++
Sbjct:    4 KVGINGFGRIGRIVFRNAIEAGTVDVVAVNDPFIETHYAAYMLKYDSQHGQFKG-TIETYDEGLIVNGKK-IRFHTERDPANIPWGQDGAEYIVESTGVFTTQEKASAHLKGGAKKVVISAPSADAPMFVMGVNNETYKKDI 143          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_CLAPU (Glyceraldehyde-3-phosphate dehydrogenase OS=Claviceps purpurea GN=GPD-1 PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 4.413e-32
Identity = 74/139 (53.24%), Postives = 90/139 (64.75%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEY 497
            VK+GINGFGRIGR+V R  ++  ++E+VAVNDPFI  +Y  YM KYDS HG +K  E+K KD   L+   K V     R+P  IPW  +GAEY+VESTGVFT               VIISAPS DAPM+V+GVNE  Y
Sbjct:    3 VKVGINGFGRIGRIVFRNAVEHPEIEVVAVNDPFIDPEYAAYMLKYDSSHGVFK-GEIK-KDADGLIVNGKKVKFHTERDPSAIPWKASGAEYIVESTGVFTTTEKAKAHLTGGAKKVIISAPSADAPMYVMGVNEKTY 139          
The following BLAST results are available for this feature:
BLAST of FC876224 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 307
Match NameE-valueIdentityDescription
G3P2_CAEBR1.981e-3250.00Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Caen... [more]
G3P_USTMA3.379e-3248.97Glyceraldehyde-3-phosphate dehydrogenase OS=Ustila... [more]
G3P_NEUCR3.379e-3251.08Glyceraldehyde 3-phosphate-dehydrogenase OS=Neuros... [more]
G3P_GLOMM3.379e-3252.82Glyceraldehyde-3-phosphate dehydrogenase OS=Glossi... [more]
G3P_ASPNG3.379e-3249.30Glyceraldehyde-3-phosphate dehydrogenase OS=Asperg... [more]
G3PT_DANRE3.379e-3249.31Glyceraldehyde 3-phosphate dehydrogenase, testis-s... [more]
G3P_TRIAT4.413e-3250.36Glyceraldehyde-3-phosphate dehydrogenase OS=Tricho... [more]
G3P_RHIMI4.413e-3253.15Glyceraldehyde-3-phosphate dehydrogenase OS=Rhizom... [more]
G3P_EMENI4.413e-3250.00Glyceraldehyde-3-phosphate dehydrogenase OS=Emeric... [more]
G3P_CLAPU4.413e-3253.24Glyceraldehyde-3-phosphate dehydrogenase OS=Clavic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32002A02EF DevOvary1 Citrus clementina cDNA clone C32002A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876224 ID=FC876224|Name=FC876224|organism=Citrus clementina|type=EST|length=509bp
GGACTGCTCTCTCTACTCTCTACAACTTTCTTCACCACTCTTTCACCGCT
CAATTTCATCTCTCGAGAATCATGGGGAAGGTCAAGATCGGAATCAACGG
ATTCGGAAGAATTGGTAGGCTGGTGGCAAGAGTCATCTTGCAGAGGGACG
ATGTTGAACTCGTTGCTGTTAATGATCCCTTTATCACAACCGATTACATG
ACATACATGTGTAAGTACGACAGTGTTCACGGTCAATGGAAGCACCATGA
ATTGAAGGTTAAGGACGATAAGACCCTTCTCTTTGGTGAGAAGCCTGTCA
CTGTTTTCGGTGTTAGGAACCCAGAGGAGATCCCATGGGCTGAGACTGGA
GCCGAGTATGTTGTGGAGTCGACTGGAGTCTTTACAGACAAGGATAAGGC
TGCTGCCCATTTGAAGGGTGGTGCTAAGAAAGTTATCATCTCAGCCCCCA
GCAAGGATGCTCCTATGTTTGTTGTGGGTGTCAATGAGCACGAGTACAAA
CCAGAGCTC
back to top