FC876326

Overview
NameFC876326
Unique NameFC876326
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length696
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15191 contig Ccv1_Contig15191:2..697. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CAD8A_ORYSJ (Probable cinnamyl alcohol dehydrogenase 8A OS=Oryza sativa subsp. japonica GN=CAD8A PE=2 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 5.354e-58
Identity = 104/172 (60.47%), Postives = 125/172 (72.67%), Query Frame = 1
Query:  115 AFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            A GWAARD SG LSPF F+RR   E DVT KV +CGICH+DLH IKNEWGNA+YP+VPGHEIVGVV  VG+ V++FK GD VGVG  V SCR+CDSC    ENYCP +++T     + G  T GG+SD MV  + +V+R+P   P D  APLLCAG+TVYS +  YGL+ PG
Sbjct:    8 ALGWAARDASGHLSPFSFTRRVQEEDDVTIKVLYCGICHTDLHTIKNEWGNAMYPVVPGHEIVGVVAGVGAGVTRFKAGDTVGVGYFVDSCRACDSCGKGDENYCPTMVITSNGTDYGGATTQGGFSDVMVVRQDYVLRVPASLPPDGAAPLLCAGVTVYSPMVEYGLNAPG 179          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH6_ORYSJ (Probable cinnamyl alcohol dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CAD6 PE=2 SV=2)

HSP 1 Score: 222.246 bits (565), Expect = 2.035e-57
Identity = 101/172 (58.72%), Postives = 125/172 (72.67%), Query Frame = 1
Query:  103 HPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGL 618
            H +   GWAA D SG + PF F RR  G  DVT KV +CG+CH+DLH I N+WG  +YP+VPGHEI GVVT+VG+ V+ FKVGD+VGVGC+  SC  C+ C    ENYC KV +TY   + DG+ITYGGYS  +VA + FVVRIP+  PLDA APLLCAGITVYS ++ +G+
Sbjct:    7 HTQTVSGWAAMDESGKIVPFVFKRRENGVDDVTIKVKYCGMCHTDLHFIHNDWGITMYPVVPGHEITGVVTKVGTNVAGFKVGDRVGVGCIAASCLDCEHCRRSEENYCDKVALTYNGIFWDGSITYGGYSGMLVAHKRFVVRIPDTLPLDAAAPLLCAGITVYSPMKQHGM 178          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH2_PICAB (Probable cinnamyl alcohol dehydrogenase 2 OS=Picea abies GN=CAD2 PE=3 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.722e-56
Identity = 102/177 (57.63%), Postives = 131/177 (74.01%), Query Frame = 1
Query:  100 EHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            E  K   G+AARD+SG LSP+ ++ R  G +DV  +V +CGICHSDL  + NE G + YP+VPGHE+VGVVTE+GS+V KFKVG+ VGVGC+VGSCRSC +C   +E YC K I TY    HDGT T GG++ +MV D+ FVVRIPE  PL+  APLLCAG+TVYS ++ +G+ +PG
Sbjct:    5 ESEKTVTGYAARDSSGHLSPYTYTLRNKGPEDVIVRVIYCGICHSDLVQMHNEMGMSNYPMVPGHEVVGVVTEIGSEVKKFKVGEHVGVGCIVGSCRSCSNCNGSMEQYCSKRIWTYNDVNHDGTPTQGGFASSMVVDQMFVVRIPENLPLEQAAPLLCAGVTVYSPMKHFGMTEPG 181          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH7_PICAB (Probable cinnamyl alcohol dehydrogenase 7/8 OS=Picea abies GN=CAD7 PE=2 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 3.837e-56
Identity = 101/177 (57.06%), Postives = 131/177 (74.01%), Query Frame = 1
Query:  100 EHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            E  +   G+AARD+SG LSP+ ++ R  G +DV  +V +CGICHSDL  + NE G + YP+VPGHE+VGVVTE+GS+V KFKVG+ VGVGC+VGSCRSC +C   +E YC K I TY    HDGT T GG++ +MV D+ FVVRIPE  PL+  APLLCAG+TVYS ++ +G+ +PG
Sbjct:    5 ESERTVTGYAARDSSGHLSPYTYTLRNKGPEDVIVRVIYCGICHSDLVQMHNEMGMSNYPMVPGHEVVGVVTEIGSEVKKFKVGEHVGVGCIVGSCRSCSNCNGSMEQYCSKRIWTYNDVNHDGTPTQGGFASSMVVDQMFVVRIPENLPLEQAAPLLCAGVTVYSPMKHFGMTEPG 181          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH_PINTA (Probable cinnamyl alcohol dehydrogenase OS=Pinus taeda PE=2 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 5.011e-56
Identity = 100/177 (56.50%), Postives = 131/177 (74.01%), Query Frame = 1
Query:  100 EHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            E  K   G+AARD+SG LSP+ ++ R  G +DV  KV +CGICHSDL  ++NE G + YP+VPGHE+VG+VTE+GS+V KFKVG+ VGVGC+VGSCRSC +C   +E YC K I TY    HDGT T GG++ +MV D+ FVVRIPE  PL+  APLLCAG+TV+S ++ + + +PG
Sbjct:    5 ESEKTVTGYAARDSSGHLSPYTYNLRKKGPEDVIVKVIYCGICHSDLVQMRNEMGMSHYPMVPGHEVVGIVTEIGSEVKKFKVGEHVGVGCIVGSCRSCGNCNQSMEQYCSKRIWTYNDVNHDGTPTQGGFASSMVVDQMFVVRIPENLPLEQAAPLLCAGVTVFSPMKHFAMTEPG 181          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH_PINRA (Probable cinnamyl alcohol dehydrogenase OS=Pinus radiata GN=CAD PE=2 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 6.545e-56
Identity = 100/177 (56.50%), Postives = 131/177 (74.01%), Query Frame = 1
Query:  100 EHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            E  K   G+AARD+SG LSP+ ++ R  G +DV  KV +CGICHSDL  ++NE G + YP+VPGHE+VG+VTE+GS+V KFKVG+ VGVGC+VGSCRSC +C   +E YC K I TY    HDGT T GG++ +MV D+ FVVRIPE  PL+  APLLCAG+TV+S ++ + + +PG
Sbjct:    5 ETEKTVTGYAARDSSGHLSPYTYNLRKKGPEDVIVKVIYCGICHSDLVQMRNEMGMSHYPMVPGHEVVGIVTEIGSEVKKFKVGEHVGVGCIVGSCRSCGNCNQSMEQYCSKRIWTYNDVNHDGTPTQGGFASSMVVDQMFVVRIPENLPLEQAAPLLCAGVTVFSPMKHFAMTEPG 181          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH9_ORYSJ (Probable cinnamyl alcohol dehydrogenase 9 OS=Oryza sativa subsp. japonica GN=CAD9 PE=2 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 7.236e-55
Identity = 99/185 (53.51%), Postives = 129/185 (69.73%), Query Frame = 1
Query:   97 QEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEG------APLDATAPLLCAGITVYSLLRFYGLDKPGM 633
            ++ PK   GWAARD +G+LSPF +  RA G++DV  K+  CGICHSDL  IKNEWGNA YP+VPGHEIVGVV EVGS V++F  GD VGVG +  +CR+C +C    ENYC  ++ ++ +   DG   +GG+S+  V ++ +VVRIP G      APLD  APLLCAG+TVY  +R  GLD+PG+
Sbjct:    2 EQQPKMVTGWAARDANGLLSPFSYPLRAKGDEDVVVKILFCGICHSDLSTIKNEWGNAKYPVVPGHEIVGVVAEVGSSVARFAAGDTVGVGYIASTCRACANCRDGFENYCAGLVPSFNAALPDGATVHGGFSELAVVNQRYVVRIPGGGGGASPAPLDRLAPLLCAGVTVYCPMRRLGLDRPGV 186          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH4_ARATH (Cinnamyl alcohol dehydrogenase 4 OS=Arabidopsis thaliana GN=CAD4 PE=1 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 2.105e-54
Identity = 101/175 (57.71%), Postives = 126/175 (72.00%), Query Frame = 1
Query:  109 KNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPGM 633
            K A GWAARD SGVLSP+ ++ R+TG  DV  KV  CGICH+D+H IKN+ G + YP+VPGHE+VG V EVGS VSKF VGD VGVG +VG C SC  C+ +LE YC K I +Y   Y DG  T GG++DTM+ ++ FVV+IPEG  ++  APLLCAG+TVYS L  +GL   G+
Sbjct:    9 KKALGWAARDPSGVLSPYSYTLRSTGADDVYIKVICCGICHTDIHQIKNDLGMSNYPMVPGHEVVGEVLEVGSDVSKFTVGDVVGVGVVVGCCGSCKPCSSELEQYCNKRIWSYNDVYTDGKPTQGGFADTMIVNQKFVVKIPEGMAVEQAAPLLCAGVTVYSPLSHFGLMASGL 183          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH2_TOBAC (Probable cinnamyl alcohol dehydrogenase 2 OS=Nicotiana tabacum GN=CAD19 PE=1 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 3.591e-54
Identity = 98/174 (56.32%), Postives = 127/174 (72.99%), Query Frame = 1
Query:  109 KNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            K+A GWAARD SG+LSP+ ++ R TG +DV  KV +CG+CHSDLH +KN+ G + YP+VPGHE+VG V EVG+ VSKFKVGD VGVG +VGSCR+C  C  ++E YC K I      Y DG  T GG++++MV D++FVV+IPEG   +  APLLCAGITVYS    +G ++ G
Sbjct:    8 KSAIGWAARDPSGLLSPYTYTLRNTGPEDVQVKVLYCGLCHSDLHQVKNDLGMSNYPLVPGHEVVGKVVEVGADVSKFKVGDTVGVGLLVGSCRNCGPCKREIEQYCNKKIWNCNDVYTDGKPTQGGFANSMVVDQNFVVKIPEGMAPEQAAPLLCAGITVYSPFNHFGFNQSG 181          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH1_TOBAC (Probable cinnamyl alcohol dehydrogenase 1 OS=Nicotiana tabacum GN=CAD14 PE=1 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 6.126e-54
Identity = 100/178 (56.18%), Postives = 124/178 (69.66%), Query Frame = 1
Query:  100 EHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPGM 633
            E  K   GWAARD SGVLSP+ ++ R TG +DV  KV +CG+CH+DLH +KN+ G + YP+VPGHE+VG V EVG  VSKFKVGD VGVG +VGSCR+C  C  D+E YC K I      Y DG  T GG++ +MV D+ FVV+IPEG   +  APLLCAGITVYS L  +G  + G+
Sbjct:    5 EVEKTTIGWAARDPSGVLSPYTYTLRNTGPEDVEVKVLYCGLCHTDLHQVKNDLGMSNYPLVPGHEVVGEVVEVGPDVSKFKVGDTVGVGLLVGSCRNCGPCKRDIEQYCNKKIWNCNDVYTDGKPTQGGFAKSMVVDQKFVVKIPEGMAPEQAAPLLCAGITVYSPLNHFGFKQSGL 182          
The following BLAST results are available for this feature:
BLAST of FC876326 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 105
Match NameE-valueIdentityDescription
CAD8A_ORYSJ5.354e-5860.47Probable cinnamyl alcohol dehydrogenase 8A OS=Oryz... [more]
CADH6_ORYSJ2.035e-5758.72Probable cinnamyl alcohol dehydrogenase 6 OS=Oryza... [more]
CADH2_PICAB1.722e-5657.63Probable cinnamyl alcohol dehydrogenase 2 OS=Picea... [more]
CADH7_PICAB3.837e-5657.06Probable cinnamyl alcohol dehydrogenase 7/8 OS=Pic... [more]
CADH_PINTA5.011e-5656.50Probable cinnamyl alcohol dehydrogenase OS=Pinus t... [more]
CADH_PINRA6.545e-5656.50Probable cinnamyl alcohol dehydrogenase OS=Pinus r... [more]
CADH9_ORYSJ7.236e-5553.51Probable cinnamyl alcohol dehydrogenase 9 OS=Oryza... [more]
CADH4_ARATH2.105e-5457.71Cinnamyl alcohol dehydrogenase 4 OS=Arabidopsis th... [more]
CADH2_TOBAC3.591e-5456.32Probable cinnamyl alcohol dehydrogenase 2 OS=Nicot... [more]
CADH1_TOBAC6.126e-5456.18Probable cinnamyl alcohol dehydrogenase 1 OS=Nicot... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003D08EF DevOvary1 Citrus clementina cDNA clone C32003D08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876326 ID=FC876326|Name=FC876326|organism=Citrus clementina|type=EST|length=696bp
GATTGCACCTTGTTTATTCAAATACCCTGGACGTCAAACTAAGCCAACAA
GCACCAATATCATTAAATTCATTCTGAAATGGGGCAAGCACCGGAGCAAG
AGCACCCTAAGAACGCCTTTGGATGGGCTGCCAGGGACACTTCTGGCGTT
CTCTCCCCCTTTCACTTCTCCAGAAGAGCAACGGGAGAGAAGGATGTGAC
ATTCAAAGTAACTCACTGTGGGATATGCCATTCAGATCTTCACTTGATCA
AAAATGAATGGGGCAATGCCATTTACCCAATCGTCCCCGGACATGAGATT
GTGGGCGTAGTGACAGAGGTCGGAAGCAAAGTGAGTAAATTCAAAGTCGG
AGACAAAGTGGGAGTAGGATGCATGGTGGGATCATGCCGCTCTTGTGATA
GCTGCGCCATTGATCTTGAGAACTACTGCCCCAAAGTTATAATGACCTAT
GCCAGCAAGTACCATGATGGAACCATCACATACGGAGGCTACTCTGACAC
TATGGTTGCCGATGAGCACTTTGTGGTCCGTATTCCTGAAGGCGCACCAC
TTGACGCCACTGCCCCTCTCCTCTGTGCTGGTATCACAGTCTACAGTCTG
TTGAGATTCTATGGACTCGACAAGCCTGGTATGCATGTGGGTGTTGTCGG
CTTGGGCGGTCTAGGCCATGTCGCTGTCAAATCGCAAGGCTATGGG
back to top