FC876326

Overview
NameFC876326
Unique NameFC876326
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length696
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15191 contig Ccv1_Contig15191:2..697. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH6_YEAST (NADP-dependent alcohol dehydrogenase 6 OS=Saccharomyces cerevisiae GN=ADH6 PE=1 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 5.392e-34
Identity = 69/140 (49.29%), Postives = 86/140 (61.43%), Query Frame = 1
Query:  187 EKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKV-SKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLL 603
            + D+  K+  CG+C SD+H     WGN   P+V GHEIVG V ++G K  S  KVG +VGVG  V SC  CD C  D E YC K + TY+  Y DG ++ GGY++ +   EHFVV IPE  P    APLLC G+TVYS L
Sbjct:   33 DHDIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGPKSNSGLKVGQRVGVGAQVFSCLECDRCKNDNEPYCTKFVTTYSQPYEDGYVSQGGYANYVRVHEHFVVPIPENIPSHLAAPLLCGGLTVYSPL 172          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: YL498_MIMIV (Probable zinc-type alcohol dehydrogenase-like protein L498 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L498 PE=1 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 4.421e-28
Identity = 64/188 (34.04%), Postives = 100/188 (53.19%), Query Frame = 1
Query:   67 IHSEMGQAPEQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPK-VIMTYASKYH-------DGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLR 606
            + +E  ++P++     A G+   D    +    F R+     +V+ ++ + GICHSD H I  EW  A +P++PGHE++G V ++G  V K+ +GD V V  ++ SC  C  C   +E +C       Y  K          G ITYGGYS+ ++  +HFV + P+   ++  APL+CAG T YS LR
Sbjct:   58 LKNEYQKSPDK---MTALGFGVTDVGKPVELLVFDRKKPTNNEVSIEIYYTGICHSDWHFIVGEW-KADFPLIPGHELIGRVIDIGPNVDKYSIGDIVCVSPVIDSCGHCKMCTHHIEQHCMNGATEIYNQKTRLPGDIKPSGPITYGGYSNIVIIKQHFVYKFPKNLDIERCAPLMCAGATTYSPLR 241          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH7_YEAST (NADP-dependent alcohol dehydrogenase 7 OS=Saccharomyces cerevisiae GN=ADH7 PE=1 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 2.194e-27
Identity = 62/148 (41.89%), Postives = 85/148 (57.43%), Query Frame = 1
Query:  166 FSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKV-SKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKV-IMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLL 603
            F  +  G+ DV  ++  CGIC SD H+    WG      + GHEI+G V +VGSK  +  K+GD+VGVG    +C  C+ C  D E YC    ++T  + Y DG I+ GG++  +   EHF ++IPE  P    APLLC GITV+S L
Sbjct:   26 FDPKPFGDHDVDVEIEACGICGSDFHIAVGNWGPVPENQILGHEIIGRVVKVGSKCHTGVKIGDRVGVGAQALACFECERCKSDNEQYCTNDHVLTMWTPYKDGYISQGGFASHVRLHEHFAIQIPENIPSPLAAPLLCGGITVFSPL 173          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: YJGB_ECOLI (Uncharacterized zinc-type alcohol dehydrogenase-like protein yjgB OS=Escherichia coli (strain K12) GN=yjgB PE=3 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 5.975e-25
Identity = 58/163 (35.58%), Postives = 92/163 (56.44%), Query Frame = 1
Query:  124 WAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSK--FKVGDKVGVGCMVGSCRSCDSCAIDLENYCPK-VIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLL 603
            +AA++  G L  + +       +DV  +V +CGICHSDL +I NEWG + YP+V GHE++G V  +GS       +VG +VG+G    SC  CD+C    +  C +  + T  ++        GG+++ + AD  +V+ +PE   +++  PLLC GITV+  L
Sbjct:    7 YAAKEAGGELEVYEYDPGELRPQDVEVQVDYCGICHSDLSMIDNEWGFSQYPLVAGHEVIGRVVALGSAAQDKGLQVGQRVGIGWTARSCGHCDACISGNQINCEQGAVPTIMNR--------GGFAEKLRADWQWVIPLPENIDIESAGPLLCGGITVFKPL 161          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH1_BACST (Alcohol dehydrogenase OS=Bacillus stearothermophilus GN=adhT PE=1 SV=2)

HSP 1 Score: 107.842 bits (268), Expect = 5.592e-23
Identity = 54/147 (36.73%), Postives = 80/147 (54.42%), Query Frame = 1
Query:  193 DVTFKVTHCGICHSDLHLIKNEWG-NAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            +V  ++  CG+CH+DLH    +W      P++PGHE VGV+ EVG  V+  KVGD+VG+  +  +C  CD C    E  C +       + + G    GGY++   A   +VV+IP+    +  AP+ CAG+T Y  L+  G  KPG
Sbjct:   27 EVLVRIKACGVCHTDLHAAHGDWPVKPKLPLIPGHEGVGVIEEVGPGVTHLKVGDRVGIPWLYSACGHCDYCLSGQETLCER-------QQNAGYSVDGGYAEYCRAAADYVVKIPDNLSFEEAAPIFCAGVTTYKALKVTGA-KPG 165          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH2_BACST (Alcohol dehydrogenase OS=Bacillus stearothermophilus GN=adh PE=1 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.246e-22
Identity = 54/149 (36.24%), Postives = 78/149 (52.35%), Query Frame = 1
Query:  187 EKDVTFKVTHCGICHSDLHLIKNEWG-NAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            E +V  K+  CG+CH+DLH    +W      P++PGHE VG+V EV   V   KVGD+VG+  +  +C  C+ C    E  CP        + + G    GGY++   A   +V +IP+       AP+LCAG+T Y  L+  G  +PG
Sbjct:   25 EGEVLVKIEACGVCHTDLHAAHGDWPIKPKLPLIPGHEGVGIVVEVAKGVKSIKVGDRVGIPWLYSACGECEYCLTGQETLCP-------HQLNGGYSVDGGYAEYCKAPADYVAKIPDNLDPVEVAPILCAGVTTYKALKVSGA-RPG 165          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH3_BACST (Alcohol dehydrogenase OS=Bacillus stearothermophilus PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.627e-22
Identity = 54/147 (36.73%), Postives = 79/147 (53.74%), Query Frame = 1
Query:  193 DVTFKVTHCGICHSDLHLIKNEWG-NAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            +V  ++  CG+CH+DLH    +W      P++PGHE VG+V EVG  V+  KVGD+VG+  +  +C  CD C    E  C         + + G    GGY++   A   +VV+IP+    +  AP+ CAG+T Y  L+  G  KPG
Sbjct:   27 EVLVRIKACGVCHTDLHAAHGDWPVKPKLPLIPGHEGVGIVEEVGPGVTHLKVGDRVGIPWLYSACGHCDYCLSGQETLC-------EHQKNAGYSVDGGYAEYCRAAADYVVKIPDNLSFEEAAPIFCAGVTTYKALKVTGA-KPG 165          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH1_NEUCR (Alcohol dehydrogenase 1 OS=Neurospora crassa GN=adh-1 PE=3 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.775e-22
Identity = 61/181 (33.70%), Postives = 91/181 (50.28%), Query Frame = 1
Query:   91 PEQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAI-YPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            P+ E P+  +        G +       +  G  +V   V + G+CH+DLH +K +W  A   P+V GHE  GVV   G  V++ +VGD  G+  + GSC +C  C    E  CP  +++       G    G +    +A    V +IP+G  L+ TAP+LCAGITVY  L+  G+ +PG
Sbjct:    2 PQFEIPEQQWAQVVEKKGGPVVFKQIPVQKPGPDEVLINVKYSGVCHTDLHAMKGDWPLATKMPLVGGHEGAGVVVAKGELVTEVEVGDHAGIKWLNGSCLACSFCMQADEPLCPHALLS-------GYTVDGSFQQYAIAKAAHVAKIPKGCDLETTAPVLCAGITVYKGLKESGV-RPG 174          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH_SCHPO (Alcohol dehydrogenase OS=Schizosaccharomyces pombe GN=adh1 PE=1 SV=2)

HSP 1 Score: 104.375 bits (259), Expect = 6.183e-22
Identity = 51/142 (35.92%), Postives = 80/142 (56.34%), Query Frame = 1
Query:  184 GEKDVTFKVTHCGICHSDLHLIKNEWG-NAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLR 606
            G+ +V   + + G+CH+DLH ++ +W   A  P++ GHE  GVV +VG+ V++ K+GD+VGV  M  SC +C+ C    E  CP + ++       G    G +    +A+      IPE  PL+  AP++CAGIT Y  L+
Sbjct:   32 GQDEVLVNIKYTGVCHTDLHALQGDWPLPAKMPLIGGHEGAGVVVKVGAGVTRLKIGDRVGVKWMNSSCGNCEYCMKAEETICPHIQLS-------GYTVDGTFQHYCIANATHATIIPESVPLEVAAPIMCAGITCYRALK 166          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH1_ASPFN (Alcohol dehydrogenase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=adh1 PE=2 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 1.799e-21
Identity = 54/150 (36.00%), Postives = 82/150 (54.67%), Query Frame = 1
Query:  184 GEKDVTFKVTHCGICHSDLHLIKNEWGNAI-YPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            G  ++  KV + G+CH+DLH +K +W   +  P+V GHE  GVV   G  V++F++GD  G+  + GSC +C+ C    E  CP   ++       G    G +    +       ++P+  PLDA AP+LCAGITVY  L+  G+ +PG
Sbjct:   30 GPDEILVKVRYSGVCHTDLHALKGDWPLPVKMPLVGGHEGAGVVVARGDLVTEFEIGDHAGLKWLNGSCLACEFCKQADEPLCPNASLS-------GYTVDGTFQQYAIGKATHASKLPKNVPLDAVAPVLCAGITVYKGLKESGV-RPG 171          
The following BLAST results are available for this feature:
BLAST of FC876326 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 105
Match NameE-valueIdentityDescription
ADH6_YEAST5.392e-3449.29NADP-dependent alcohol dehydrogenase 6 OS=Saccharo... [more]
YL498_MIMIV4.421e-2834.04Probable zinc-type alcohol dehydrogenase-like prot... [more]
ADH7_YEAST2.194e-2741.89NADP-dependent alcohol dehydrogenase 7 OS=Saccharo... [more]
YJGB_ECOLI5.975e-2535.58Uncharacterized zinc-type alcohol dehydrogenase-li... [more]
ADH1_BACST5.592e-2336.73Alcohol dehydrogenase OS=Bacillus stearothermophil... [more]
ADH2_BACST1.246e-2236.24Alcohol dehydrogenase OS=Bacillus stearothermophil... [more]
ADH3_BACST1.627e-2236.73Alcohol dehydrogenase OS=Bacillus stearothermophil... [more]
ADH1_NEUCR2.775e-2233.70Alcohol dehydrogenase 1 OS=Neurospora crassa GN=ad... [more]
ADH_SCHPO6.183e-2235.92Alcohol dehydrogenase OS=Schizosaccharomyces pombe... [more]
ADH1_ASPFN1.799e-2136.00Alcohol dehydrogenase 1 OS=Aspergillus flavus (str... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003D08EF DevOvary1 Citrus clementina cDNA clone C32003D08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876326 ID=FC876326|Name=FC876326|organism=Citrus clementina|type=EST|length=696bp
GATTGCACCTTGTTTATTCAAATACCCTGGACGTCAAACTAAGCCAACAA
GCACCAATATCATTAAATTCATTCTGAAATGGGGCAAGCACCGGAGCAAG
AGCACCCTAAGAACGCCTTTGGATGGGCTGCCAGGGACACTTCTGGCGTT
CTCTCCCCCTTTCACTTCTCCAGAAGAGCAACGGGAGAGAAGGATGTGAC
ATTCAAAGTAACTCACTGTGGGATATGCCATTCAGATCTTCACTTGATCA
AAAATGAATGGGGCAATGCCATTTACCCAATCGTCCCCGGACATGAGATT
GTGGGCGTAGTGACAGAGGTCGGAAGCAAAGTGAGTAAATTCAAAGTCGG
AGACAAAGTGGGAGTAGGATGCATGGTGGGATCATGCCGCTCTTGTGATA
GCTGCGCCATTGATCTTGAGAACTACTGCCCCAAAGTTATAATGACCTAT
GCCAGCAAGTACCATGATGGAACCATCACATACGGAGGCTACTCTGACAC
TATGGTTGCCGATGAGCACTTTGTGGTCCGTATTCCTGAAGGCGCACCAC
TTGACGCCACTGCCCCTCTCCTCTGTGCTGGTATCACAGTCTACAGTCTG
TTGAGATTCTATGGACTCGACAAGCCTGGTATGCATGTGGGTGTTGTCGG
CTTGGGCGGTCTAGGCCATGTCGCTGTCAAATCGCAAGGCTATGGG
back to top