FC876326

Overview
NameFC876326
Unique NameFC876326
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length696
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15191 contig Ccv1_Contig15191:2..697. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH5_YEAST (Alcohol dehydrogenase 5 OS=Saccharomyces cerevisiae GN=ADH5 PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.166e-20
Identity = 59/173 (34.10%), Postives = 86/173 (49.71%), Query Frame = 1
Query:   91 PEQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAI-YPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLR 606
            P Q  P+        +T G L     +       ++   V + G+CHSDLH    +W   + +P++ GHE  GVV ++GS V  +KVGD  G+  + G+C SC+ C +  E+ CP +  T  +  HDGT     + +   AD      IP    L   AP+LCAGITVY  L+
Sbjct:    2 PSQVIPEKQKAIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGHEGAGVVVKLGSNVKGWKVGDFAGIKWLNGTCMSCEYCEVGNESQCPYLDGTGFT--HDGT-----FQEYATADAVQAAHIPPNVNLAEVAPILCAGITVYKALK 167          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH5_SACPS (Alcohol dehydrogenase 5 OS=Saccharomyces pastorianus GN=ADH5 PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.166e-20
Identity = 59/173 (34.10%), Postives = 86/173 (49.71%), Query Frame = 1
Query:   91 PEQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAI-YPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLR 606
            P Q  P+        +T G L     +       ++   V + G+CHSDLH    +W   + +P++ GHE  GVV ++GS V  +KVGD  G+  + G+C SC+ C +  E+ CP +  T  +  HDGT     + +   AD      IP    L   AP+LCAGITVY  L+
Sbjct:    2 PSQVIPEKQKAIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGHEGAGVVVKLGSNVKGWKVGDFAGIKWLNGTCMSCEYCEVGNESQCPYLDGTGFT--HDGT-----FQEYATADAVQAAHIPPNVNLAEVAPILCAGITVYKALK 167          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH3_EMENI (Alcohol dehydrogenase 3 OS=Emericella nidulans GN=alcC PE=3 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.523e-20
Identity = 55/152 (36.18%), Postives = 80/152 (52.63%), Query Frame = 1
Query:  184 GEKDVTFKVTHCGICHSDLHLIKNEWG-NAIYPIVPGHEIVGVVTEVGSKVSK--FKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            G  ++  K+ + G+CH+DLH +K +W   +  P++ GHE  GVV   G  V    FK+GD+ G+  + GSC SC+ C    E  CP   ++       G    G +    +       +IP+  PLDA AP+LCAGITVY  L+  G  +PG
Sbjct:   30 GPDEILVKMRYSGVCHTDLHAMKGDWPLPSKMPLIGGHEGAGVVVAKGELVKDEDFKIGDRAGIKWLNGSCLSCEMCMQADEPLCPHASLS-------GYTVDGTFQQYTIGKAALASKIPDNVPLDAAAPILCAGITVYKGLKESGA-RPG 173          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH3_KLULA (Alcohol dehydrogenase 3, mitochondrial OS=Kluyveromyces lactis GN=ADH3 PE=3 SV=2)

HSP 1 Score: 98.2117 bits (243), Expect = 4.431e-20
Identity = 51/139 (36.69%), Postives = 74/139 (53.24%), Query Frame = 1
Query:  193 DVTFKVTHCGICHSDLHLIKNEWGNAI-YPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLR 606
            ++   V + G+CH+DLH  K +W      P+V GHE  GVV  +G  V  + +GD  G+  + GSC SC+ C +  E+ CP   +  +   HDG+     +     AD     RIP+G  L   AP+LCAG+TVY  L+
Sbjct:   59 EILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNCPDADL--SGYTHDGS-----FQQYATADAVQAARIPKGTDLAEVAPILCAGVTVYKALK 190          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH2_KLUMA (Alcohol dehydrogenase 2 OS=Kluyveromyces marxianus GN=ADH2 PE=3 SV=3)

HSP 1 Score: 97.8265 bits (242), Expect = 5.787e-20
Identity = 50/139 (35.97%), Postives = 74/139 (53.24%), Query Frame = 1
Query:  193 DVTFKVTHCGICHSDLHLIKNEWG-NAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLR 606
            ++   V + G+CH+DLH  K +W  +   P+V GHE  GVV  +G  V  +K+GD  G+  + GSC +C+ C +  E+ CP   +  +   HDG+     +     AD      IP G  L   AP+LCAG+TVY  L+
Sbjct:   33 ELLINVKYSGVCHTDLHAWKGDWPLDTKLPLVGGHEGAGVVVAMGDNVKGWKIGDLAGIKWLNGSCMNCEECELSNESNCPDADL--SGYTHDGS-----FQQYATADAVQAAHIPAGTDLAQVAPILCAGVTVYKALK 164          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH2_KLULA (Alcohol dehydrogenase 2 OS=Kluyveromyces lactis GN=ADH2 PE=3 SV=2)

HSP 1 Score: 97.4413 bits (241), Expect = 7.558e-20
Identity = 51/139 (36.69%), Postives = 74/139 (53.24%), Query Frame = 1
Query:  193 DVTFKVTHCGICHSDLHLIKNEWGNAI-YPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLR 606
            ++   V + G+CH+DLH  K +W      P+V GHE  GVV  +G  V  + +GD  G+  + GSC SC+ C +  E+ CP   +  +   HDG+     +     AD     RIP+G  L   AP+LCAG+TVY  L+
Sbjct:   33 ELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNCPDADL--SGYTHDGS-----FQQYATADAVQAARIPKGTDLAEVAPILCAGVTVYKALK 164          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH1_KLUMA (Alcohol dehydrogenase 1 OS=Kluyveromyces marxianus GN=ADH1 PE=3 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 7.558e-20
Identity = 49/139 (35.25%), Postives = 76/139 (54.68%), Query Frame = 1
Query:  193 DVTFKVTHCGICHSDLHLIKNEWG-NAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLR 606
            ++   V + G+CH+DLH  + +W  +   P+V GHE  G+V  +G  V+ +++GD  G+  + GSC SC+ C +  E  CPK  +  +   HDG+     +     AD     RIP+   L   AP+LCAG+TVY  L+
Sbjct:   33 ELLINVKYSGVCHTDLHAWQGDWPLDTKLPLVGGHEGAGIVVAMGENVTGWEIGDYAGIKWLNGSCMSCEECELSNEPNCPKADL--SGYTHDGS-----FQQYATADAVQAARIPKNVDLAEVAPILCAGVTVYKALK 164          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH1_KLULA (Alcohol dehydrogenase 1 OS=Kluyveromyces lactis GN=ADH1 PE=3 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 7.558e-20
Identity = 51/139 (36.69%), Postives = 75/139 (53.96%), Query Frame = 1
Query:  193 DVTFKVTHCGICHSDLHLIKNEWGNAI-YPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLR 606
            ++   V + G+CH+DLH  K +W      P+V GHE  GVV  +G  V  +K+GD  G+  + GSC SC+ C +  E+ CP+  +  +   HDG+     +     AD     +IP G  L   AP+LCAG+TVY  L+
Sbjct:   35 ELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVAMGENVKGWKIGDFAGIKWLNGSCMSCEYCELSNESNCPEADL--SGYTHDGS-----FQQYATADAVQAAKIPVGTDLAEVAPVLCAGVTVYKALK 166          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH1_EMENI (Alcohol dehydrogenase 1 OS=Emericella nidulans GN=alcA PE=3 SV=2)

HSP 1 Score: 97.4413 bits (241), Expect = 7.558e-20
Identity = 51/150 (34.00%), Postives = 78/150 (52.00%), Query Frame = 1
Query:  184 GEKDVTFKVTHCGICHSDLHLIKNEWGNAI-YPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            G   +  K+ + G+CH+DLH +   W   +  P+V GHE  G+V   G  V +F++GD+ G+  + GSC  C+ C    +  C +  ++       G    G +    +       +IP G PLDA AP+LCAGITVY  L+  G+ +PG
Sbjct:   30 GPDQILVKIRYSGVCHTDLHAMMGHWPIPVKMPLVGGHEGAGIVVAKGELVHEFEIGDQAGIKWLNGSCGECEFCRQSDDPLCARAQLS-------GYTVDGTFQQYALGKASHASKIPAGVPLDAAAPVLCAGITVYKGLKEAGV-RPG 171          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH4_KLULA (Alcohol dehydrogenase 4, mitochondrial OS=Kluyveromyces lactis GN=ADH4 PE=3 SV=2)

HSP 1 Score: 97.0561 bits (240), Expect = 9.871e-20
Identity = 53/147 (36.05%), Postives = 78/147 (53.06%), Query Frame = 1
Query:  193 DVTFKVTHCGICHSDLHLIKNEWGNAI-YPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            ++   V + G+CH+DLH  K +W   +  P+V GHE  G+V   G  V  F++GD  G+  + GSC SC+ C    E+ C +  +  +   HDG+     +     AD     +IP+G  L   AP+LCAG+TVY  L+   L KPG
Sbjct:   60 EILINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGAGIVVAKGENVKNFEIGDYAGIKWLNGSCMSCELCEQGYESNCLQADL--SGYTHDGS-----FQQYATADAVQAAQIPKGTDLAEIAPILCAGVTVYKALKTADL-KPG 198          
The following BLAST results are available for this feature:
BLAST of FC876326 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 105
Match NameE-valueIdentityDescription
ADH5_YEAST1.166e-2034.10Alcohol dehydrogenase 5 OS=Saccharomyces cerevisia... [more]
ADH5_SACPS1.166e-2034.10Alcohol dehydrogenase 5 OS=Saccharomyces pastorian... [more]
ADH3_EMENI1.523e-2036.18Alcohol dehydrogenase 3 OS=Emericella nidulans GN=... [more]
ADH3_KLULA4.431e-2036.69Alcohol dehydrogenase 3, mitochondrial OS=Kluyvero... [more]
ADH2_KLUMA5.787e-2035.97Alcohol dehydrogenase 2 OS=Kluyveromyces marxianus... [more]
ADH2_KLULA7.558e-2036.69Alcohol dehydrogenase 2 OS=Kluyveromyces lactis GN... [more]
ADH1_KLUMA7.558e-2035.25Alcohol dehydrogenase 1 OS=Kluyveromyces marxianus... [more]
ADH1_KLULA7.558e-2036.69Alcohol dehydrogenase 1 OS=Kluyveromyces lactis GN... [more]
ADH1_EMENI7.558e-2034.00Alcohol dehydrogenase 1 OS=Emericella nidulans GN=... [more]
ADH4_KLULA9.871e-2036.05Alcohol dehydrogenase 4, mitochondrial OS=Kluyvero... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003D08EF DevOvary1 Citrus clementina cDNA clone C32003D08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876326 ID=FC876326|Name=FC876326|organism=Citrus clementina|type=EST|length=696bp
GATTGCACCTTGTTTATTCAAATACCCTGGACGTCAAACTAAGCCAACAA
GCACCAATATCATTAAATTCATTCTGAAATGGGGCAAGCACCGGAGCAAG
AGCACCCTAAGAACGCCTTTGGATGGGCTGCCAGGGACACTTCTGGCGTT
CTCTCCCCCTTTCACTTCTCCAGAAGAGCAACGGGAGAGAAGGATGTGAC
ATTCAAAGTAACTCACTGTGGGATATGCCATTCAGATCTTCACTTGATCA
AAAATGAATGGGGCAATGCCATTTACCCAATCGTCCCCGGACATGAGATT
GTGGGCGTAGTGACAGAGGTCGGAAGCAAAGTGAGTAAATTCAAAGTCGG
AGACAAAGTGGGAGTAGGATGCATGGTGGGATCATGCCGCTCTTGTGATA
GCTGCGCCATTGATCTTGAGAACTACTGCCCCAAAGTTATAATGACCTAT
GCCAGCAAGTACCATGATGGAACCATCACATACGGAGGCTACTCTGACAC
TATGGTTGCCGATGAGCACTTTGTGGTCCGTATTCCTGAAGGCGCACCAC
TTGACGCCACTGCCCCTCTCCTCTGTGCTGGTATCACAGTCTACAGTCTG
TTGAGATTCTATGGACTCGACAAGCCTGGTATGCATGTGGGTGTTGTCGG
CTTGGGCGGTCTAGGCCATGTCGCTGTCAAATCGCAAGGCTATGGG
back to top