FC876326

Overview
NameFC876326
Unique NameFC876326
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length696
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15191 contig Ccv1_Contig15191:2..697. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH2_PICST (Alcohol dehydrogenase 2 OS=Pichia stipitis GN=ADH2 PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.199e-19
Identity = 51/139 (36.69%), Postives = 75/139 (53.96%), Query Frame = 1
Query:  193 DVTFKVTHCGICHSDLHLIKNEWG-NAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLR 606
            ++   V + G+CH+DLH  K +W  +   P+V GHE  GVV  +G  V+ +++GD  G+  + GSC  C+ C    E+ CP   +  +   HDG+     +     AD     RIP+G  L   AP+LCAGITVY  L+
Sbjct:   33 ELLINVKYSGVCHTDLHAWKGDWPLDTKLPLVGGHEGAGVVVALGENVTGWEIGDYAGIKWINGSCLQCEYCVTAHESNCPDADL--SGYTHDGS-----FQQYATADAIQAARIPKGTDLALIAPILCAGITVYKALK 164          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH1_YEAST (Alcohol dehydrogenase 1 OS=Saccharomyces cerevisiae GN=ADH1 PE=1 SV=4)

HSP 1 Score: 95.9005 bits (237), Expect = 2.199e-19
Identity = 50/139 (35.97%), Postives = 74/139 (53.24%), Query Frame = 1
Query:  193 DVTFKVTHCGICHSDLHLIKNEWGNAI-YPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLR 606
            ++   V + G+CH+DLH    +W   +  P+V GHE  GVV  +G  V  +K+GD  G+  + GSC +C+ C +  E+ CP   +  +   HDG+     +     AD      IP+G  L   AP+LCAGITVY  L+
Sbjct:   33 ELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADL--SGYTHDGS-----FQQYATADAVQAAHIPQGTDLAQVAPILCAGITVYKALK 164          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH3_YEAST (Alcohol dehydrogenase 3, mitochondrial OS=Saccharomyces cerevisiae GN=ADH3 PE=1 SV=2)

HSP 1 Score: 95.5153 bits (236), Expect = 2.872e-19
Identity = 50/139 (35.97%), Postives = 75/139 (53.96%), Query Frame = 1
Query:  193 DVTFKVTHCGICHSDLHLIKNEWGNAI-YPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLR 606
            ++   V + G+CH+DLH    +W   +  P+V GHE  GVV ++GS V  +KVGD  G+  + GSC +C+ C    E+ CP   +  +   HDG+     +     AD     +I +G  L   AP+LCAG+TVY  L+
Sbjct:   60 EILINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNCPDADL--SGYTHDGS-----FQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVYKALK 191          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH1_PICST (Alcohol dehydrogenase 1 OS=Pichia stipitis GN=ADH1 PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.872e-19
Identity = 51/139 (36.69%), Postives = 76/139 (54.68%), Query Frame = 1
Query:  193 DVTFKVTHCGICHSDLHLIKNEWG-NAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLR 606
            ++   V + G+CH+DLH  K +W  +   P+V GHE  GVV  +GS V+ +++GD  G+  + GSC +C+ C    E  C K  +  +   HDG+     +     AD     R+P+G  L   AP+LCAGITVY  L+
Sbjct:   33 EILINVKYSGVCHTDLHAWKGDWPLDTKLPLVGGHEGAGVVVGIGSNVTGWELGDYAGIKWLNGSCLNCEFCQHSDEPNCAKADL--SGYTHDGS-----FQQYATADAVQAARLPKGTDLAQAAPILCAGITVYKALK 164          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH2_YEAST (Alcohol dehydrogenase 2 OS=Saccharomyces cerevisiae GN=ADH2 PE=1 SV=3)

HSP 1 Score: 95.1301 bits (235), Expect = 3.751e-19
Identity = 50/139 (35.97%), Postives = 74/139 (53.24%), Query Frame = 1
Query:  193 DVTFKVTHCGICHSDLHLIKNEWGNAI-YPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLR 606
            ++   V + G+CH+DLH    +W      P+V GHE  GVV  +G  V  +K+GD  G+  + GSC +C+ C +  E+ CP   +  +   HDG+     + +   AD      IP+G  L   AP+LCAGITVY  L+
Sbjct:   33 ELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADL--SGYTHDGS-----FQEYATADAVQAAHIPQGTDLAEVAPILCAGITVYKALK 164          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH2_CANAL (Alcohol dehydrogenase 2 OS=Candida albicans GN=ADH2 PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 3.751e-19
Identity = 53/139 (38.13%), Postives = 73/139 (52.52%), Query Frame = 1
Query:  193 DVTFKVTHCGICHSDLHLIKNEWGNAI-YPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLR 606
            ++   V + G+CH+DLH  K +W  A   P+V GHE  GVV  +G  V  +KVGD  GV  + GSC +C+ C    E  C +  +  +   HDG+     +     AD     RIP G  L   AP+LCAG+TVY  L+
Sbjct:   33 ELLINVKYSGVCHTDLHAWKGDWPLATKLPLVGGHEGAGVVVALGENVKGWKVGDYAGVKWLNGSCLNCEYCQSGAEPNCAEADL--SGYTHDGS-----FQQYATADAVQAARIPAGTDLANVAPILCAGVTVYKALK 164          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADHA_RHIME (Alcohol dehydrogenase OS=Rhizobium meliloti GN=adhA PE=3 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.425e-18
Identity = 51/142 (35.92%), Postives = 73/142 (51.41%), Query Frame = 1
Query:  184 GEKDVTFKVTHCGICHSDLHLIKNEWG-NAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLR 606
            G   V  K    G+CH+DLH  K +W      P +PGHE VG V ++G++V++ K GD+VGV  +  +C  C  C    E  C        S+ + G    G ++   +AD  FV R+P        AP+LCAG+TVY  L+
Sbjct:   26 GPGQVLIKYEATGVCHTDLHAAKGDWPVRPNPPFIPGHEGVGYVAKLGAEVTRLKEGDRVGVPWLHTACGCCTPCRTGWETLC-------GSQQNTGYSVDGTFAQYGLADPDFVGRLPARLEFGPAAPVLCAGVTVYKGLK 160          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH1_CANAL (Alcohol dehydrogenase 1 OS=Candida albicans GN=ADH1 PE=1 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.862e-18
Identity = 51/139 (36.69%), Postives = 73/139 (52.52%), Query Frame = 1
Query:  193 DVTFKVTHCGICHSDLHLIKNEWGNAI-YPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLR 606
            ++   V + G+CH+DLH  K +W  A   P+V GHE  GVV  +G  V  +K+GD  G+  + GSC SC+ C    E  C +  +  +   HDG+     +     AD     +IP G  L   AP+LCAG+TVY  L+
Sbjct:   35 ELLIHVKYSGVCHTDLHARKGDWPLATKLPLVGGHEGAGVVVGMGENVKGWKIGDFAGIKWLNGSCMSCEFCQQGAEPNCGEADL--SGYTHDGS-----FEQYATADAVQAAKIPAGTDLANVAPILCAGVTVYKALK 166          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH2_EMENI (Alcohol dehydrogenase 2 OS=Emericella nidulans GN=alcB PE=3 SV=2)

HSP 1 Score: 92.0485 bits (227), Expect = 3.176e-18
Identity = 50/147 (34.01%), Postives = 76/147 (51.70%), Query Frame = 1
Query:  184 GEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPG----HEIVGVVTEVGS--KVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLR 606
            G+ +V   +TH G+CHSD  ++ N W    +P  PG    HE VG V ++G+  + S  K+GD+VGV  +  +C  C  C    +  C        ++   G  T G +   ++    +V  IP+G P    APLLCAG+TVY+ L+
Sbjct:   34 GDNEVLINLTHSGVCHSDFGIMTNTWKILPFPTQPGQVGGHEGVGKVVKLGAGAEASGLKIGDRVGVKWISSACGQCPPCQDGADGLC-------FNQKVSGYYTPGTFQQYVLGPAQYVTPIPDGLPSAEAAPLLCAGVTVYASLK 173          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH_STAEQ (Alcohol dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=adh PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 5.417e-18
Identity = 44/142 (30.99%), Postives = 76/142 (53.52%), Query Frame = 1
Query:  205 KVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            K  +CG+CH+DLH+   ++G+ +  +  GHE +G V EV   V   KVGD+V +  M  +C +C+ C    E  C  V+       + G    G  ++ ++ D ++ V++PE     A + + CAG+T Y  ++  G++ PG
Sbjct:   30 KTEYCGVCHTDLHVKNADFGD-VTGVTLGHEGIGRVIEVADNVDSLKVGDRVSIAWMYAACGNCEYCTTGRETLCRDVL-------NAGYTVDGAMAEEVIVDANYAVKVPENLDPAAASSITCAGVTTYKAVKVSGIE-PG 162          
The following BLAST results are available for this feature:
BLAST of FC876326 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 105
Match NameE-valueIdentityDescription
ADH2_PICST2.199e-1936.69Alcohol dehydrogenase 2 OS=Pichia stipitis GN=ADH2... [more]
ADH1_YEAST2.199e-1935.97Alcohol dehydrogenase 1 OS=Saccharomyces cerevisia... [more]
ADH3_YEAST2.872e-1935.97Alcohol dehydrogenase 3, mitochondrial OS=Saccharo... [more]
ADH1_PICST2.872e-1936.69Alcohol dehydrogenase 1 OS=Pichia stipitis GN=ADH1... [more]
ADH2_YEAST3.751e-1935.97Alcohol dehydrogenase 2 OS=Saccharomyces cerevisia... [more]
ADH2_CANAL3.751e-1938.13Alcohol dehydrogenase 2 OS=Candida albicans GN=ADH... [more]
ADHA_RHIME1.425e-1835.92Alcohol dehydrogenase OS=Rhizobium meliloti GN=adh... [more]
ADH1_CANAL1.862e-1836.69Alcohol dehydrogenase 1 OS=Candida albicans GN=ADH... [more]
ADH2_EMENI3.176e-1834.01Alcohol dehydrogenase 2 OS=Emericella nidulans GN=... [more]
ADH_STAEQ5.417e-1830.99Alcohol dehydrogenase OS=Staphylococcus epidermidi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003D08EF DevOvary1 Citrus clementina cDNA clone C32003D08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876326 ID=FC876326|Name=FC876326|organism=Citrus clementina|type=EST|length=696bp
GATTGCACCTTGTTTATTCAAATACCCTGGACGTCAAACTAAGCCAACAA
GCACCAATATCATTAAATTCATTCTGAAATGGGGCAAGCACCGGAGCAAG
AGCACCCTAAGAACGCCTTTGGATGGGCTGCCAGGGACACTTCTGGCGTT
CTCTCCCCCTTTCACTTCTCCAGAAGAGCAACGGGAGAGAAGGATGTGAC
ATTCAAAGTAACTCACTGTGGGATATGCCATTCAGATCTTCACTTGATCA
AAAATGAATGGGGCAATGCCATTTACCCAATCGTCCCCGGACATGAGATT
GTGGGCGTAGTGACAGAGGTCGGAAGCAAAGTGAGTAAATTCAAAGTCGG
AGACAAAGTGGGAGTAGGATGCATGGTGGGATCATGCCGCTCTTGTGATA
GCTGCGCCATTGATCTTGAGAACTACTGCCCCAAAGTTATAATGACCTAT
GCCAGCAAGTACCATGATGGAACCATCACATACGGAGGCTACTCTGACAC
TATGGTTGCCGATGAGCACTTTGTGGTCCGTATTCCTGAAGGCGCACCAC
TTGACGCCACTGCCCCTCTCCTCTGTGCTGGTATCACAGTCTACAGTCTG
TTGAGATTCTATGGACTCGACAAGCCTGGTATGCATGTGGGTGTTGTCGG
CTTGGGCGGTCTAGGCCATGTCGCTGTCAAATCGCAAGGCTATGGG
back to top