FC919304

Overview
NameFC919304
Unique NameFC919304
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length607
Libraries
Library NameType
PCRcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC919304_ssr438 microsatellite FC919304_ssr438:438..449. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig2562 contig Ccv1_Contig2562:245..854. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP2_GOSHI (Non-specific lipid-transfer protein OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.097e-26
Identity = 57/94 (60.64%), Postives = 71/94 (75.53%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLR-TGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            A+T GQVT SLAPCI +LR +G    PP CC+G++SLN AA+TTP RQAAC C+K A   I GI   +A+GLP +CG+ IPYKISPSTDC+ V+
Sbjct:   27 AVTSGQVTNSLAPCINYLRGSGAGAVPPGCCTGIKSLNSAAQTTPVRQAACRCIKSAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCNSVK 120          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP1_GOSHI (Non-specific lipid-transfer protein OS=Gossypium hirsutum PE=3 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.097e-26
Identity = 57/94 (60.64%), Postives = 71/94 (75.53%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLR-TGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            A+T GQVT SLAPCI +LR +G    PP CC+G++SLN AA+TTP RQAAC C+K A   I GI   +A+GLP +CG+ IPYKISPSTDC+ V+
Sbjct:   23 AVTSGQVTNSLAPCINYLRGSGAGAVPPGCCTGIKSLNSAAQTTPVRQAACRCIKSAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCNSVK 116          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP2_SORBI (Non-specific lipid-transfer protein 2 OS=Sorghum bicolor GN=LTP2 PE=3 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.432e-26
Identity = 55/92 (59.78%), Postives = 67/92 (72.83%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            A+TCGQV++++ PC+ + R  G  P   CCSGVRSLN AARTT DR+AACNCLK A   IRG+    AA +P +CG+ IPY IS STDCSRV
Sbjct:   30 AVTCGQVSSAIGPCLSYARGQGSGPSAGCCSGVRSLNSAARTTADRRAACNCLKNAARGIRGLNVGKAASIPSKCGVSIPYTISTSTDCSRV 121          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP1_SOLLC (Non-specific lipid-transfer protein 1 OS=Solanum lycopersicum GN=TSW12 PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.432e-26
Identity = 57/97 (58.76%), Postives = 70/97 (72.16%), Query Frame = 1
Query:  100 PVTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            P   A+TCGQVTA LAPC+P+L+  GR P   CC GV++L G+A+TT DR+ AC CLK A   I+GI  N AAG+P  C + IPYKISPSTDCS V+
Sbjct:   20 PHAEALTCGQVTAGLAPCLPYLQ--GRGPLGGCCGGVKNLLGSAKTTADRKTACTCLKSAANAIKGIDLNKAAGIPSVCKVNIPYKISPSTDCSTVQ 114          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP1_SOLPN (Non-specific lipid-transfer protein 1 OS=Solanum pennellii GN=LTP1 PE=3 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.871e-26
Identity = 57/97 (58.76%), Postives = 69/97 (71.13%), Query Frame = 1
Query:  100 PVTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            P   A+TCGQVTA LAPC+P+L+  GR P   CC GV+ L G+A+TT DR+ AC CLK A   I+GI  N AAG+P  C + IPYKISPSTDCS V+
Sbjct:   20 PHAEALTCGQVTAGLAPCLPYLQ--GRGPLGGCCGGVKGLLGSAKTTADRKTACTCLKSAANAIKGIDLNKAAGIPSVCKVNIPYKISPSTDCSTVQ 114          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP_MAIZE (Non-specific lipid-transfer protein OS=Zea mays PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 3.191e-26
Identity = 55/92 (59.78%), Postives = 66/92 (71.74%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            AI+CGQV +++APCI + R  G  P   CCSGVRSLN AARTT DR+AACNCLK A   + G+    AA +P +CG+ IPY IS STDCSRV
Sbjct:   28 AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP1_LENCU (Non-specific lipid-transfer protein 1 OS=Lens culinaris PE=3 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 4.167e-26
Identity = 53/93 (56.99%), Postives = 70/93 (75.27%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            AI+CG V+ +L PC+ +L+ GG  P P CC GV+ LNGAARTT DR+AACNCLK + G+I G+KP   A LP +CG+R+PY IS ST+C+ +R
Sbjct:   26 AISCGTVSGALVPCLTYLK-GGPGPSPQCCGGVKRLNGAARTTIDRRAACNCLKSSAGSISGLKPGNVATLPGKCGVRLPYTISTSTNCNTIR 117          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP4_LENCU (Non-specific lipid-transfer protein 4 (Fragment) OS=Lens culinaris PE=1 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 7.108e-26
Identity = 55/93 (59.14%), Postives = 68/93 (73.12%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            AI+CG VT+ L+PC+ +L TGG  P P CC GV+ L  AA TTPDRQAACNCLK A G+I  +  N AA LP +CG+ IPYKIS ST+C+ V+
Sbjct:   18 AISCGAVTSDLSPCLTYL-TGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTSTNCNTVK 109          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP6_LENCU (Non-specific lipid-transfer protein 6 OS=Lens culinaris PE=1 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.212e-25
Identity = 55/93 (59.14%), Postives = 68/93 (73.12%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            AI+CG VT+ L+PC+ +L TGG  P P CC GV+ L  AA TTPDRQAACNCLK A G+I  +  N AA LP +CG+ IPYKIS ST+C+ V+
Sbjct:   26 AISCGAVTSDLSPCLTYL-TGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVDIPYKISTSTNCNTVK 117          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP2_LENCU (Non-specific lipid-transfer protein 2 OS=Lens culinaris PE=1 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.584e-25
Identity = 54/93 (58.06%), Postives = 68/93 (73.12%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            AI+CG VT+ L+PC+ +L TGG  P P CC GV+ L  AA TTPDRQAACNCLK A G+I  +  N AA LP +CG+ IPYKIS +T+C+ V+
Sbjct:   26 AISCGAVTSDLSPCLTYL-TGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117          
The following BLAST results are available for this feature:
BLAST of FC919304 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 80
Match NameE-valueIdentityDescription
NLTP2_GOSHI1.097e-2660.64Non-specific lipid-transfer protein OS=Gossypium h... [more]
NLTP1_GOSHI1.097e-2660.64Non-specific lipid-transfer protein OS=Gossypium h... [more]
NLTP2_SORBI1.432e-2659.78Non-specific lipid-transfer protein 2 OS=Sorghum b... [more]
NLTP1_SOLLC1.432e-2658.76Non-specific lipid-transfer protein 1 OS=Solanum l... [more]
NLTP1_SOLPN1.871e-2658.76Non-specific lipid-transfer protein 1 OS=Solanum p... [more]
NLTP_MAIZE3.191e-2659.78Non-specific lipid-transfer protein OS=Zea mays PE... [more]
NLTP1_LENCU4.167e-2656.99Non-specific lipid-transfer protein 1 OS=Lens culi... [more]
NLTP4_LENCU7.108e-2659.14Non-specific lipid-transfer protein 4 (Fragment) O... [more]
NLTP6_LENCU1.212e-2559.14Non-specific lipid-transfer protein 6 OS=Lens culi... [more]
NLTP2_LENCU1.584e-2558.06Non-specific lipid-transfer protein 2 OS=Lens culi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC06055A06T7 PCR Citrus clementina cDNA clone C06055A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC919304 ID=FC919304|Name=FC919304|organism=Citrus clementina|type=EST|length=607bp
TGATAACTAGCTATAACCAAGCAAAAGCCTCCCTGAAGAATCCTCATGGC
TGCTCTTAAGCTTGTTTGTGCTTTGCTTTTGTGCATTCTGGTGACTGCCC
CGGTGACTAATGCCATAACATGCGGGCAGGTGACAGCCTCCTTGGCTCCA
TGCATCCCTTTCTTGAGAACTGGAGGGCGTTTTCCTCCACCGCCATGCTG
TAGCGGCGTCAGGTCTCTCAACGGCGCCGCCAGAACCACCCCTGACCGCC
AAGCTGCATGCAACTGCTTGAAACGAGCTTACGGAACAATCCGCGGCATC
AAACCTAATGTTGCCGCTGGCCTTCCTANTCAATGTGGAATCAGAATTCC
TTACAAGATCAGCCCCAGCACCGACTGCTCTAGGGTCAGGTGAAGTTGAG
TTTGAGCTCTGTGACTTTCCAAGTATGATTGACTGAGAATAAATAAATAA
AGAATATCTATGTTAATTTCTTTGTCCGAACGAGTCTCCACTTGTATGAG
TTTCACTCTCATGTCATGTTTGTATATTTGCTTTTTATGTCATATTAAAT
ATGTAAACGCGATCTGTGTTTTGAGTGATTAATTATAGTTATTTTGTGGT
ATTATCT
back to top