FC919304

Overview
NameFC919304
Unique NameFC919304
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length607
Libraries
Library NameType
PCRcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC919304_ssr438 microsatellite FC919304_ssr438:438..449. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig2562 contig Ccv1_Contig2562:245..854. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP2_TOBAC (Non-specific lipid-transfer protein 2 OS=Nicotiana tabacum PE=3 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 2.701e-25
Identity = 54/97 (55.67%), Postives = 68/97 (70.10%), Query Frame = 1
Query:  100 PVTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            P   A++CGQV + LAPC+P+L+  GR P   CC GV+ L GAA++  DR+ AC CLK A   I+GI    AAGLP  CG+ IPYKISPSTDCS+V+
Sbjct:   20 PHAEALSCGQVQSGLAPCLPYLQ--GRGPLGSCCGGVKGLLGAAKSLSDRKTACTCLKSAANAIKGIDMGKAAGLPGACGVNIPYKISPSTDCSKVQ 114          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP2_SOLLC (Non-specific lipid-transfer protein 2 OS=Solanum lycopersicum GN=LE16 PE=2 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 2.701e-25
Identity = 54/97 (55.67%), Postives = 68/97 (70.10%), Query Frame = 1
Query:  100 PVTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            P   +++CG+VT+ LAPC+P+L   GR P   CC GV+ L GAA+T  DR+ AC CLK A  +I+GI    AAGLP  CG+ IPYKISPSTDCS V+
Sbjct:   20 PHAESLSCGEVTSGLAPCLPYLE--GRGPLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP_DAUCA (Non-specific lipid-transfer protein OS=Daucus carota GN=EP2 PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 3.528e-25
Identity = 52/92 (56.52%), Postives = 67/92 (72.83%), Query Frame = 1
Query:  115 ITCGQVTASLAPCIPFLRTGGRFPPP-PCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            +TCGQVT +LAPC+ +LR+    P P  CC+ VR LN AARTT D++ AC CLK+    + G+  N AAGLP +CG+ IPYKISP+TDC+RV
Sbjct:   28 LTCGQVTGALAPCLGYLRSQVNVPVPLTCCNVVRGLNNAARTTLDKRTACGCLKQTANAVTGLNLNAAAGLPARCGVNIPYKISPTTDCNRV 119          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP_CICAR (Non-specific lipid-transfer protein OS=Cicer arietinum PE=3 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 3.528e-25
Identity = 55/94 (58.51%), Postives = 69/94 (73.40%), Query Frame = 1
Query:  109 NAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            +AITCG+V  +LAPC+ +L+ GG  P   CC GVR+LN AA TTPDRQAACNCLK A G+I  +  N AA LP +C + IPYKIS ST+C+ +R
Sbjct:   23 SAITCGRVDTALAPCLGYLQ-GGPGPSAQCCGGVRNLNSAAVTTPDRQAACNCLKSAAGSISRLNANNAAALPGKCVVNIPYKISTSTNCATIR 115          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP4_ORYSJ (Non-specific lipid-transfer protein 4 OS=Oryza sativa subsp. japonica GN=Os12g0114500 PE=3 SV=2)

HSP 1 Score: 114.775 bits (286), Expect = 3.528e-25
Identity = 51/96 (53.12%), Postives = 65/96 (67.71%), Query Frame = 1
Query:  100 PVTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            P  +A+TCGQV + LAPCI +       P   CC GVR+LN AA TT DRQ  C CLK+    + G++P++ AG+P +CG+ IPY ISPSTDCSRV
Sbjct:   23 PAASAVTCGQVVSMLAPCIMYATGRVSAPTGGCCDGVRTLNSAAATTADRQTTCACLKQQTSAMGGLRPDLVAGIPSKCGVNIPYAISPSTDCSRV 118          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP4_ARATH (Non-specific lipid-transfer protein 4 OS=Arabidopsis thaliana GN=LTP4 PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 3.528e-25
Identity = 52/96 (54.17%), Postives = 71/96 (73.96%), Query Frame = 1
Query:  103 VTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            V  AITCG V +SL+PC+ +L  GG   PPPCC+GV+ LNG A+TTPDRQ AC CL+ A    +G+ P++A+GLP +CG+ IPY IS ST+C+ ++
Sbjct:   21 VDAAITCGTVASSLSPCLGYLSKGG-VVPPPCCAGVKKLNGMAQTTPDRQQACRCLQSA---AKGVNPSLASGLPGKCGVSIPYPISTSTNCATIK 112          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP5_LENCU (Non-specific lipid-transfer protein 5 OS=Lens culinaris PE=3 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 7.859e-25
Identity = 53/93 (56.99%), Postives = 66/93 (70.97%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            AI+CG VT  L+PC+ +L TGG  P P CC GV+ L  AA TTPDRQAACNC+K A  +I  +  N AA LP +CG+ IPYKIS ST+C+ V+
Sbjct:   25 AISCGAVTGDLSPCLTYL-TGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCMKSAASSITKLNTNNAAALPGKCGVNIPYKISTSTNCNTVK 116          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP3_LENCU (Non-specific lipid-transfer protein 3 OS=Lens culinaris PE=3 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.341e-24
Identity = 52/93 (55.91%), Postives = 65/93 (69.89%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            A++CG VT  LAPCIP+L TGG  P   CC+GV+ L  AA TT DRQAACNCLK A G I  + P  AA LP +C + IPYKIS +T+C+ ++
Sbjct:   26 AVSCGTVTGDLAPCIPYL-TGGAGPTDSCCAGVKKLLAAAPTTADRQAACNCLKTAAGNINNLNPGNAAALPGKCNVNIPYKISTTTNCNTIK 117          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP1_SORBI (Non-specific lipid-transfer protein 1 OS=Sorghum bicolor GN=LTP1 PE=3 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.341e-24
Identity = 53/92 (57.61%), Postives = 66/92 (71.74%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            AI+CGQV++++A C+ + R  G  P   CCSGVRSLN AARTT DR+AACNCLK A   I G+    AA +P +CG+ +PY IS STDCSRV
Sbjct:   26 AISCGQVSSAIALCLSYARGQGFAPSAGCCSGVRSLNSAARTTADRRAACNCLKNAARGISGLNAGNAASIPSKCGVSVPYTISTSTDCSRV 117          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP2_ORYSI (Non-specific lipid-transfer protein 2 OS=Oryza sativa subsp. indica GN=LTP2-A PE=3 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.751e-24
Identity = 52/92 (56.52%), Postives = 65/92 (70.65%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            AI+CGQV ++++PC+ + R GG  P   CCSGVRSLN AA TT DR+ ACNCLK   G+I G+    AA +P +CG+ IPY ISPS DCS V
Sbjct:   27 AISCGQVNSAVSPCLSYAR-GGSGPSAACCSGVRSLNSAASTTADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSSV 117          
The following BLAST results are available for this feature:
BLAST of FC919304 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 80
Match NameE-valueIdentityDescription
NLTP2_TOBAC2.701e-2555.67Non-specific lipid-transfer protein 2 OS=Nicotiana... [more]
NLTP2_SOLLC2.701e-2555.67Non-specific lipid-transfer protein 2 OS=Solanum l... [more]
NLTP_DAUCA3.528e-2556.52Non-specific lipid-transfer protein OS=Daucus caro... [more]
NLTP_CICAR3.528e-2558.51Non-specific lipid-transfer protein OS=Cicer ariet... [more]
NLTP4_ORYSJ3.528e-2553.13Non-specific lipid-transfer protein 4 OS=Oryza sat... [more]
NLTP4_ARATH3.528e-2554.17Non-specific lipid-transfer protein 4 OS=Arabidops... [more]
NLTP5_LENCU7.859e-2556.99Non-specific lipid-transfer protein 5 OS=Lens culi... [more]
NLTP3_LENCU1.341e-2455.91Non-specific lipid-transfer protein 3 OS=Lens culi... [more]
NLTP1_SORBI1.341e-2457.61Non-specific lipid-transfer protein 1 OS=Sorghum b... [more]
NLTP2_ORYSI1.751e-2456.52Non-specific lipid-transfer protein 2 OS=Oryza sat... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC06055A06T7 PCR Citrus clementina cDNA clone C06055A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC919304 ID=FC919304|Name=FC919304|organism=Citrus clementina|type=EST|length=607bp
TGATAACTAGCTATAACCAAGCAAAAGCCTCCCTGAAGAATCCTCATGGC
TGCTCTTAAGCTTGTTTGTGCTTTGCTTTTGTGCATTCTGGTGACTGCCC
CGGTGACTAATGCCATAACATGCGGGCAGGTGACAGCCTCCTTGGCTCCA
TGCATCCCTTTCTTGAGAACTGGAGGGCGTTTTCCTCCACCGCCATGCTG
TAGCGGCGTCAGGTCTCTCAACGGCGCCGCCAGAACCACCCCTGACCGCC
AAGCTGCATGCAACTGCTTGAAACGAGCTTACGGAACAATCCGCGGCATC
AAACCTAATGTTGCCGCTGGCCTTCCTANTCAATGTGGAATCAGAATTCC
TTACAAGATCAGCCCCAGCACCGACTGCTCTAGGGTCAGGTGAAGTTGAG
TTTGAGCTCTGTGACTTTCCAAGTATGATTGACTGAGAATAAATAAATAA
AGAATATCTATGTTAATTTCTTTGTCCGAACGAGTCTCCACTTGTATGAG
TTTCACTCTCATGTCATGTTTGTATATTTGCTTTTTATGTCATATTAAAT
ATGTAAACGCGATCTGTGTTTTGAGTGATTAATTATAGTTATTTTGTGGT
ATTATCT
back to top